cao thủ học đường 3
Trí tuệ học đường 3
... chất giữa cơ thể với môI trường thuộc loại vận động nào?Đáp án: Vận động sinh học Đáp án : Thụ phấn chéoCâu 3: Lực ma sát nào làm cho viên bi ve đứng yên trên một mặt bàn nhẵn, nằm ngang?Đáp...
- 5
- 449
- 1
ATGT + nha hoc dương 3
... Người đi trên đường nhỏ (đường huyện ) ra đường quốc lộ phải đi như thế nào ? - Đi bộ trên đường quốc lộ đường tỉnh, Đường quốc lộ, đường tỉnh, đường huyện, đường làng xã, đường đô thị.PP: Trực ... Bài 3: Biển báo hiệu giao thông đường bộ6 27/9 Bài 4: Kỹ năng đi bộ và qua đường an toàn7 4/10 Bài 5: Con đường đến trường.CHƯƠNG TRÌNH NHA HỌC ĐƯỜNG 3 An toàn giao thông Bài 1: GIAO THÔNG ĐƯỜNG ... nêu.- nghe đường huyện phải đi như thế nào ? Gv nhận xét và giáo dục hs biết giữ đúng luật giao thông khi đi đường .HĐ4 : Củng cố (3 ) Gv gắn 3 tranh về đường quốc lộ , đường phố, đường xã...
- 25
- 777
- 4
Tài liệu Báo cáo khoa học: PC1⁄3, PC2 and PC5⁄6A are targeted to dense core secretory granules by a common mechanism doc
... pathway. Biochem J 34 9 (Part 3) ,8 43 852.18 Arnaoutova I, Smith AM, Coates LC, Sharpe JC,Dhanvantari S, Snell CR, Birch NP & Loh YP (20 03) The prohormone processing enzyme PC3 is a lipid raft-associated ... morePC5/6A…ATEESWAEGGFCMLVKKNNLCQRKVLQQLCCKTCTFQGFcFcPC5/6A878-915…ATEESWAEGGFCMLVKKNNLCQRKVLQQL878-906…ATEESWAEGGFCMLVKKNNL878-891878-915878-906878-8918 83- 915012 3 ****Fold stimulation(+F/-F)…WAEGGFCMLVKKNNLCQRKVLQQLCCKTCTFQG8 83- 915-F +FCC-FABC878-9158 83- 915878-906878-891FcPC5/6AFig. 2. ... targeting of the proproteinconvertase PC1 to the regulated secretory pathway.J Biol Chem 275, 4 033 7–4 034 3.4 Zhou A, Paquet L & Mains RE (1995) Structural ele-ments that direct specific processing...
- 9
- 600
- 0
Báo cáo khoa học: SAF-3, a novel splice variant of the SAF-1/MAZ/Pur-1 family, is expressed during inflammation pptx
... repression. J Cell Physiol 2 13, 38 4 39 0. 34 Baylin SB (2002) Mechanisms underlying epigeneticallymediated gene silencing in cancer. Semin Cancer Biol12, 33 1 33 7. 35 Sambrook J & Russell DW ... BiolChem 274, 430 0– 430 8. 13 Ray A, Fields AP & Ray BK (2000) Activation oftranscription factor SAF involves its phosphorylationby protein kinase C. J Biol Chem 275, 39 727 39 733 .14 Ray BK ... expressed SAF -3 protein(Fig. 3E, lanes 1 and 2). SAF -3 expression was detectedat a low level in IL-1b-induced HTB-94 cells using thisantibody (Fig. 3E, lanes 3 and 4).Detection of SAF -3 mRNA in...
- 11
- 439
- 0
Báo cáo khoa học: Fowlicidin-3 is an a-helical cationic host defense peptide with potent antibacterial and lipopolysaccharideneutralizing activities ppt
... NationalScience Foundation (grants MCB0 236 039 andEPS0 236 9 13) , NIH (S10-RR02 239 2), Oklahoma Cen-ter for the Advancement of Science and Technology(grant HR 03- 146), and Oklahoma Agricultural Experi-ment ... (A˚) (residues 19–25)Backbone atoms 0 .34 ± 0. 13 Heavy (nonhydrogen) atoms 1.54 ± 0 .39 Percentage of residues in regions of /–w spaceCore 64.8%Allowed 33 .4%Generously allowed 1.8%Disallowed ... monocytogenes 19115 2 2Staph. aureus 259 23 1 2Staph. aureus (MRSA) 433 00 1 2Staph. aureus (MRSA) BAA -39 1 1Y. R. Bommineni et al. Structure and functions of fowlicidin -3 FEBS Journal 274 (2007) 418–428...
- 11
- 496
- 0
Báo cáo khoa học: BGN16.3, a novel acidic b-1,6-glucanase from mycoparasitic fungus Trichoderma harzianum CECT 2413 ppt
... Biol26, 131 –140.27 Dana M, Limon MC, Mejias R, Mach RL, Benitez T,Pintor-Toro JA & Kubicek CP (2001) Regulation ofchitinase 33 (chit 33) gene expression in Trichodermaharzianum. Curr Genet 38 , ... Res 105, 769–772. 32 Somogyi M (1952) Notes on sugar determination. J BiolChem 195, 19– 23. 33 Nelson NJ (1955) Colorimetric analysis of sugars. Meth-ods Enzymol 3, 85–86. 34 Laemmli UK (1970) ... harzianumFEBS Journal 272 (2005) 34 41 34 48 ª 2005 FEBS 34 47the cloned b-1,6-glucanases confirming BGN16 .3 as anovel enzyme.BGN16 .3 internal peptide showed seven of 13 aminoacids identity with a...
- 8
- 327
- 0
Báo cáo khoa học: The 3¢-UTR of the mRNA coding for the major protein kinase C substrate MARCKS contains a novel CU-rich element interacting with the mRNA stabilizing factors HuD and HuR ppt
... 2002,accepted 26 November 2002)Eur. J. Biochem. 270, 35 0 36 5 (20 03) Ó FEBS 20 03 doi:10.1046/j.1 432 -1 033 .20 03. 033 96.xNP-40, 10 mMNaCl, 3 mMMgCl2and 10 mMTris/HClpH 7.4) prior resuspending ... for transfection of Swiss 3T3 fibro-blasts. Length of the MARCKS 3 -UTR sequences [38 ] of pDK1: 131 0–2597 bp (complete 3 -UTR of MARCKS); pDK2: 131 0– 230 9 bp; pDK8: 131 0–1562 bp. The poly(A) signal ... & Keene,J.D. (19 93) Hel-N1: an autoimmune RNA-binding protein withspecificity for 3 uridylate-rich untranslated regions of growthfactor mRNAs. Mol. Cell. Biol. 13, 34 94 35 04.51. Brennan,...
- 16
- 754
- 0
Báo cáo khoa học: 14-3-3 Proteins regulate glycogen synthase 3b phosphorylation and inhibit cardiomyocyte hypertrophy doc
... isoform-independ-0 1 3 6 12 24 48 time (h)14 -3- 3βζεγ14 -3- 314 -3- 314 -3- 3B14 -3- 3 mRNA14 -3- 3 protein18sRNAAβγεζFig. 1. (A) Different isoforms of 14 -3- 3 s were expressed in cardio-myocytes. 14 -3- 3f, ... APKBPKB-ser-9-PActiveInactiveGSK3GSK3βPI3KPI3KPNFATPPNFAT14- 3 - 3 14- 3 - 3 14- 3 - 3 PNFATPPNFATGSK3GSK3βFig. 7. A working model depicts 14 -3- 3 proteins inhibiting the cardio-myocyte ... anti-14 -3- 3b, anti-14 -3- 3c, anti-14 -3- 3e,14 -3- 3 Controls cardiomyocyte hypertrophy through GSK3b W. Liao et al.1852 FEBS Journal 272 (2005) 1845–1854 ª 2005 FEBSanti-14 -3- 3f, anti-eIF-5, anti-GSK3b...
- 10
- 290
- 0
Báo cáo khoa học: Phosphatidylinositol 3,4,5-trisphosphate modulation in SHIP2-deficient mouse embryonic fibroblasts pot
... PtdIns(4,5)P2)SHIP2+/+SHIP2-/-A PtdIns (3, 4,5)P 3 levelsPtdIns (3, 4,5)P 3 levels+serum 00,10,20 ,3 0,40,50,6SHIP2+/+SHIP2-/-B + IGF-1Fig. 3. PtdIns (3, 4,5)P 3 levels in serum and IGF-1 stimulated ... 2005 FEBSof [ 32 P]-labelled lipids, we scraped off together theregion of the TLC containing both [ 32 P]PtdIns (3, 4,5)P 3 and [ 32 P]PtdIns(4,5)P2, the levels of [ 32 P]-labelled 3- phosphoinositides ... IGF-11 and 10 nM or PDGF 30 ngÆmL)1for 5 min. [ 32 P]PtdIns (3, 4,5)P 3 (upper panel) and [ 32 P]PtdIns (3, 4)P2(lower panel) are expressed asa percentage of total [ 32 P]PtdIns(4,5)P2and are...
- 11
- 303
- 0
Báo cáo khoa học: The 3-ureidopropionase of Caenorhabditis elegans, an enzyme involved in pyrimidine degradation pptx
... Biochem 217,220– 230 . 36 Bolleter WT, Bushman CJ & Tidwell PW (1961) Spec-trophotometric detection of ammonia as indophenol.Anal Chem 33 , 592–594. 37 Hiller A & van Slyke D (1 933 ) Determination ... instructions.Cloning of 3- ureidopropionaseThe cDNA of 3- ureidopropionase (gene F13H8.7) wasamplified from a cDNA library made of 1 lg of total RNAusing primers 3- UP_F (5¢-CATATGTCTGCAGCTCCGGCT -3 ) and 3- UP_R ... Chem 102, 499. 38 Traut TW & Loechel S (1984) Pyrimidine catabolism:individual characterization of the three sequentialenzymes with a new assay. Biochemistry 23, 2 533 –2 539 . 3- Ureidopropionase...
- 10
- 494
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose