Báo cáo y học: "Strange day" ppt
Báo cáo y học: "đánh giá về kết quả của plasty trước dây chằng bằng cách sử dụng các gân xương bánh chè" ppt
... tuổi. Các BN đều có tiền sử chấn thương kín khớp gối, được chẩn đoán đứt d y chằng chéo trước và phẫu thuật nội soi để tái tạo lại d y chằng. Nguyên liệu sử dụng để thay thế d y chằng chéo trước ... cho rằng sử dụng chất liệu bằng gân bánh chè để tái tạo d y chằng chéo trước là tốt nhất với nhiều ưu điểm. Tuy nhiên, việc l y gân bánh chè có thể gặp những biến chứng như vỡ xương bánh chè ... bám d y chằng mới tạo, tiến hành nội soi lại cắt tổ chức xơ dính làm duỗi gối, sau n y cho kết quả vừa. 3. Kết quả kiểm tra độ vững của khớp bằng m y KT-1000. Bảng 2: Đánh giá kết quả dựa...
- 18
- 497
- 0
Báo cáo y học: "Good chemistry" pptx
... chemistry that the best andbrightest students are more apt to go into biology, where theyend up, ironically, often working on biochemical questions. Butwhy should they stay with chemistry, when ... Chemistry bills itself as ‘The Central Science’, implying that anunderstanding of chemistry is important for many, if not mostother sciences. I agree with that sentiment, but I doubt many oftoday’s ... chemistry is so poor thatDuPont, the giant US-based chemical company, removed“Through Chemistry” from the tail end of its “Better Living”slogan. Basic chemistry courses do so poor a job of conveyingthe...
- 2
- 257
- 0
Báo cáo y học: " Decreased respiratory system compliance on the sixth day of mechanical ventilation is a predictor of death in patients with established acute lung injury" ppt
... 1):1432-1441.doi:10.1186/1465-9921-12-52Cite this article as: Seeley et al.: Decreased respiratory system compliance on the sixth day of mechanical ventilation is a predictor of death in patients with established acute lung injury. Respiratory ... 0.05.Table 3 Multivariate adjusted odds ratio of death for selected variables on day 1, day 6 and the change in eachvariable between day 1 and day 6 Day 1 Day 6 Δ Day 1 ➔ Day 6Variable OR* ... mortality.Conclusions: A low respiratory system compliance on day 6 or a decrease in the respiratory system compliance between the 1stand 6th day of mechanical ventilation were associated with increased...
- 8
- 351
- 0
Báo cáo y học: "Editorial comment" ppt
... indicator of the activity andseverity of the inflammatory response and may be used formonitoring bacterial infections.In recent years, a variety of laboratory and immunologicparameters have ... it is frequently difficult to decide on theaetiology of an inflammatory response syndrome anddirect appropriate therapy. Second, the disappointingresults of immunomodulatory trials in septic ... conventionally used labora-tory monitoring parameters, it does not fulfil all the criteriaof an ideal marker of severe microbial infections. Procalci-tonin may not or may only slightly increase...
- 2
- 198
- 0
Báo cáo y học: "Book report" ppt
...
- 1
- 222
- 0
Báo cáo y học: "Cardiopulmonary Bypass" ppt
...
- 1
- 242
- 0
Báo cáo y học: " Inconvenient truths" ppt
... has said “I’m sorry,but…”. Every time that happens, I can still hear my mothertelling me “There is no ‘but’ in an apology. If you say, ‘I’msorry, but…’, you’re not really sorry.” Just listen ... wellI enjoyed your talk The parts I was awake for sounded pretty goodYour conclusions are interesting I don’t believe a word of itThe PI has been productive If only he had produced anything worthwhileOur ... gelsAdvanced proteomics Really big two-dimensional gelsTranslational research Maybe a new buzzword will get this piece of crud fundedSystems biology Physiology, but if I called it that, no...
- 2
- 154
- 0
Báo cáo y học: "Strange day" ppt
... (interestingly enough, it already was doubling, onaverage, every 9 years since 1972). But then, starting in2004, the budget essentially went flat, and it's stayed thatway since. Now, given that by ... biomedicalresearch funding? If you had proposed that idea prior to,say, 2004, you would probably have been laughed out ofalmost every scientific society in the US, but that's exactlywhat happened. ... elections in your lifetime? Try it- it's not easy.) Or maybe, he lost because he believes theearth is millions of years old, since that seems to be the rootof all evil. Anyway, George W...
- 3
- 152
- 0
Báo cáo y học: " Medicine m" pptx
... I say, "just a cough." "Hmm," they say,"maybe. But, you know, it could be Hammacher-SchlemmerSyndrome, where your teeth turn green and then you die."You may laugh ... fromthe truth. Depending on my condition, the attention I get usually takesone of two forms. If there's something seriously wrong - say,my left arm is hanging by a tendon and the socket is ... body is almost infinite. Living with physicians is one of the things that have mademe conscious of what doctors know and what they need toknow. My having taught freshman chemistry, largely...
- 2
- 189
- 0
Báo cáo y học: " How many steps/day are enough? For older adults and special populations" ppt
... guidelines for appar-ently healthy older adults (compared to those for youngto middle-aged adults) . Any lower accommodation isonly in recognition of anyone (including both younger adults and older adults) ... absolutely-defined intensity of 3 MET intensity, atleast in younger adults [41-45]. This cadence may beunrealistic for many older adults (especially for thosewho are more frail) or for those ... REVIEW Open Access How many steps/day are enough? For older adults and special populationsCatrine Tudor-Locke1,2*, Cora L Craig2,3, Yukitoshi Aoyagi4, Rhonda C Bell5, Karen A Croteau6,Ilse...
- 19
- 391
- 0
Báo cáo y học: "Color blind" ppt
... original study,the drug combination appeared better than the standardtherapy. The new trial, exclusively in African-Americans,was begun as a consequence. So why isn’t everybody cheering? Many are, ... race. Yet we have known forhalf a century that sickle-cell anemia is overwhelmingly adisease of blacks, that Tay-Sachs Disease is overwhelminglya disease of Ashkenazi Jews, and that cystic ... by hermother to disprove that all racial groups are geneticallysimilar (you can read a synopsis of it in Sandra Soo-Jin Lee’sthoughtful review in PloS Biology 2004, 2:1263-1264). Theplay...
- 3
- 171
- 1
Báo cáo y học: "The opsins" pptx
... it.(a)IIIIIIVVVIVIISNINFRMVLTDNNCPMAFPTIGDFGAWILFVMMVTITVKQFCFVIVHVFVHQVLPPLAWT Y LVLWETFGGGGMLDAALLRT Y VTPFILML Y MALWPEEVPKGFNNNCR Y Y Y PPKMRFGLIMFASFQAL Y YQAPFSP VTNFSV Y N P G E TG ... and Technology Agency, Kyoto 606-8502, Japan. E-mail: terakita@photo2.biophys.kyoto-u.ac.jpSummaryThe photosensitive molecule rhodopsin and its relatives consist of a protein moiety - an opsin ... a GPCR.45. Okada T, Fujiyoshi Y, Silow M, Navarro J, Landau EM, Shichida Y: Functional role of internal water molecules in rhodopsinrevealed by X-ray crystallography. Proc Natl Acad Sci USA...
- 9
- 168
- 0
Báo cáo y học: "crobial metagenomics" pptx
... addressed by studies presented by CamillaNesbo (Dalhousie University) and Fraser, regarding differ-ences within the genus Thermotoga, where genomic diver-sity seems to be driven by the ecotype and ... diversity in the GI tract was also described byJeffrey Gordon (Washington University School of Medicine,St Louis, USA). There are ten times more prokaryotic cellsthan human cells in the human body; ... Meeting of the AmericanSociety for Microbiology, Atlanta, USA, 5-9 June 2005.The 105th Annual General Meeting of the American Societyfor Microbiology held recently in Atlanta, Georgia, broughttogether...
- 3
- 155
- 0
Báo cáo y học: "A day in the life of a genome biologist in the not-too-distant future" pdf
... flooding of the entire Eastern Seaboard of NorthAmerica in 2138, artifacts from the Cambrian Period, as the period of the great universities in Cambridge is called, havebeen very hard to come by. ... document is therefore of great historical significance. Nothing is known about the writer, except that similarities of style suggest that he mayactually have been the same as the master of the Genome Biology ... brace, anklerestraints and wrist locks) before exiting. Plugged batterycord into recharger built into parking meter. Inserted $255 in five dollar coins to cover daily parking and batterycharging...
- 2
- 437
- 0
Báo cáo y học: "Bacterial networking" ppt
... predominantly control anabolicpathways by mainly targeting enzymes located at thebranching points of pathways, whereas indirect feedbackoccurred in both the catabolic and anabolic pathways with-out ... by invading the host cell. This suicidal act not onlykills most of the invaders but also wipes out many competitorgut commensals, thereby clearing the way for a moresuccessful infection by ... the survival of the other phenotype. Applied tothe Salmonella typhimurium invasion phenotype, a smallhttp://genomebiology.com/2008/9/11/327GenomeBBiioollooggyy2008, Volume 9, Issue 11, Article...
- 3
- 144
- 0
Từ khóa: báo cáo y họcbáo cáo y học cổ truyềnmẫu báo cáo y học cổ truyềnbao cao y hoc colchicinphan ban luan trong bao cao y hoc co truyenbáo cáo khoa học y họcbáo cáo y tế học đườngmẫu báo cáo y tế học đườngbáo cáo y tế học đường cuối nămbáo cáo y tế học đường năm 2012báo cáo y tế học đường trường mầm nonbiểu mẫu báo cáo y tế trường họcbáo cáo khoa học ứng dụng công nghệ thông tin vào giảng dạy bộ môn tự nhiên và xã hộibáo cáo y tế học đường trường tiểu họcbáo cáo y tế trường tiểu họcNghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Thơ nôm tứ tuyệt trào phúng hồ xuân hươngSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXKiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)chuong 1 tong quan quan tri rui roNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtBÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt nam