0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Nông - Lâm - Ngư >

Optimization of expression and purification of HSPA6 protein from Camelus dromedarius in E. Coli

Báo cáo hóa học:

Báo cáo hóa học: " Bacterial-based systems for expression and purification of recombinant Lassa virus proteins of immunological relevance" doc

... cells transformed with construct pMAL-c2x:NP Expression and purification of LASV NP from E coli Rosetta Expression and purification of LASV NP from E coli Rosetta 2(DE3) cells transformed with ... transformed with construct from E coli Rosetta gami cellsand purification of LASV GP2pMAL-c2x:GP2 Expression Expression and purification of LASV GP2 from E coli Rosetta gami cells transformed ... Gami bla Figure strategy for expression of LASV proteins GP1, GP2, and NP in E coli using pMAL vectors Cloning Cloning strategy for expression of LASV proteins GP1, GP2, and NP in E coli using...
  • 14
  • 411
  • 0
báo cáo hóa học:

báo cáo hóa học: " Recombinant expression and purification of the 2,5-diketocamphane 1,2-monooxygenase from the camphor metabolizing Pseudomonas putida strain NCIMB 10007" potx

... article as: Kadow et al.: Recombinant expression and purification of the 2,5-diketocamphane 1,2-monooxygenase from the camphor metabolizing Pseudomonas putida strain NCIMB 10007 AMB Express 2011 ... amount of enzyme that catalyzes the oxidation of μmol of substrate per minute Results Cloning, expression and purification of 2, 5-diketocamphane 1,2-monooxygenase The 2,5-diketocamphane 1,2-monooxygenase ... Page of Figure Vector 2,5-DKCMO_pET-28 for expression of recombinant 2,5-DKCMO from P putida NCIMB 10007 under control of T7 promoter in E coli BL21 The 2,5-DKCMO-gene was introduced using the...
  • 8
  • 548
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Production and purification of immunologically active core protein p24 from HIV-1 fused to ricin toxin B subunit in E. coli" ppt

... with RTBp24, triggered levels of < /b> anti -p24 < /b> antibodies comparable to < /b> those obtained by immunization with p24 < /b> alone in the presence of < /b> cholera toxin < /b> Our results demonstrate that ricin < /b> toxin < /b> B subunit ... has been usually fused < /b> to < /b> the N-terminal domain of < /b> RTB to < /b> avoid steric hindrance by the antigen with RTB galactose receptor binding sites In this work, we fused < /b> p24 < /b> to < /b> the C-terminal domain of < /b> ... http://www.virologyj.com/content/6/1/17 Biological activity of < /b> RTB /p24 < /b> in vitro We measured affinity of < /b> RTB /p24 < /b> to < /b> the glycoprotein asialofetuin by capture ELISA The RTB /p24 < /b> fusion showed a strong binding activity to < /b> asialofetuin,...
  • 11
  • 292
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1

... ANALYSIS OF REGULATOR OF G- PROTEIN SIGNALING (RGS) FUNCTION IN GROWTH, DEVELOPMENT AND PATHOGENICITY OF MAGNAPORTHE GRISEA HAO LIU A THESIS SUBMITTED FOR THE DEGREE OF DOCTOR OF PHILOSOPHY ... yeast…………………………………………… 22 1. 2.2.3 G proteins in mammals………………………………………… 23 1. 2.3 Desensitization of G protein Signaling ………………………… …… 24 1. 2.3 .1 The discovery of Regulator of G- protein signaling (RGS) ……24 1. 2.3.2 ... of G protein signaling (RGS), leads to the replacement of GTP with GDP and reassociation of G with G γ heterodimer, leading to the termination of G protein- mediated signaling (Figure 3) 1. 2.2...
  • 220
  • 228
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2

... HPH1 RGS1 Figure 21 A rgs1D WT Rgs1 OP Complemented B WT rgs1D Complemented Rgs1 OP _ Figure 22 Inductive Non-inductive _ Figure 23 WT rgs1D Complemented Figure 24 Figure 25 Figure 26 Rgs1 MG00990 ... FlbA Sst2 467 27 2 479 466 QQDRSHIQQFPGCQVFQPTKHAIYHMTSKGKDMINGSVPRGRASEGDATHSATHRHG-VA QQDRAYTAQYPGSQLFQPTKHSIYQITPNGKDLINGMNSRGRTSDAESTPRDHKPNEKLP QEDKGYPQPDASIVVFQPSKYAIYGITERGQRVCG -WIARDKSRETFYDNRGMP ... ESPRNTMQLVNLERDTETDKLSHDRATIEVIFRRFAGQDGPNVKSSISTSDSDSLSDYSN FQISRSSFFTLSKRGWDLVSWTGCKSNNIRAPNGSTIDLDFTLRGHMTVRDEKKTLDDSE Rgs1 Cprgs-1 FlbA Sst2 408 21 3 420 406 GLTGVKMAPERKVNGKIHKDTFTGK-AASEWLMDCCTTVDRREAVEIASLFVEYELIEAL GLTGVKMAAERKIGGKTYKETFTGK-AATDWLMDCSTTVDRRETVEIASYFVEFGLMECV...
  • 12
  • 185
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 3

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 3

... Figure 28 Inductive Non-inductive _ Figure 29 Figure 30 Inductive Non-inductive _ Figure 31 B A Figure 32 A B Figure 33 A B Figure 34 mgb1D WT _ rgs1Dmgb1D magB G1 83Smgb1D Figure 35 Figure 36 ... mgb1D WT _ rgs1Dmgb1D magB G1 83Smgb1D Figure 35 Figure 36 MG01 031 5 MG010105 MG09 134 Control: Gamma actin MG 039 82 MG011 73 MG01 630 Figure 37 A B ...
  • 11
  • 227
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 4

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 4

... Figure 39 WT rgs1D Figure 40 Figure 41 Figure 42 _ Figure 43 - Gd + Gd, 1h + Gd, 0h + Gd, 2h + Gd, 0.5h + Gd, 3h _ Figure 44 A WT rgs1D Solvent Solvent 10mM 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D ... Solvent 10mM 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D Figure 45 Appressorium formation on inductive membrane (%) Appressorium formation on Noninductive membrane (%) WT 89 1.5 mscL∆ 92 mscS1∆ 87 2.5 ... mscS1∆ 87 2.5 mscS2∆ 91 mscS3∆ 85 mscL∆mscS1∆ 86 mscL∆mscS2∆ 92 1.5 mscL∆mscS3∆ 88 mscS1∆mscS2∆ 84 mscS1∆mscS3∆ 85 mscS2∆mscS3∆ 89 ...
  • 9
  • 180
  • 0
Báo cáo khoa học: Solution structure of the catalytic domain of RICH protein from goldfish pot

Báo cáo khoa học: Solution structure of the catalytic domain of RICH protein from goldfish pot

... The Authors Journal compilation ª 2007 FEBS 1601 Solution structure of the RICH catalytic domain G Kozlov et al Results Structure of the RICH catalytic domain We determined the structure of the ... similarity of the structures The lowest-energy structure from the RICH NMR ensemble is used for the overlay (D) The surface of the RICH catalytic domain shows several negatively charged patches of residues ... close to its Fig Structure of goldfish RICH catalytic domain (A) Stereo view of the backbone superposition of 10 lowest energy structures of the RICH catalytic domain The superposition was carried...
  • 10
  • 325
  • 0
SAVINGS BANKS'''' SOCIALLY RESPONSIBLE ACTIVITIES, A WEALTH OF EXPERIENCE: INSIGHTS FROM WSBI MEMBERS IN AFRICA, ASIA AND THE AMERICAS pot

SAVINGS BANKS'''' SOCIALLY RESPONSIBLE ACTIVITIES, A WEALTH OF EXPERIENCE: INSIGHTS FROM WSBI MEMBERS IN AFRICA, ASIA AND THE AMERICAS pot

... retail banks and associations thereof in 86 countries of the world (Asia- Pacific, the Americas, Africa and Europe – via the European Savings Banks Group) At the start of 2005, assets of member banks ... ensure the participation of Brazilian Athletics Teams in more than 30 national and international competitions and in 15 other Caixa events that are part of the National Calendar of Sports Caixa also ... JapanPost - Special time savings  Case Study 3: National Savings Bank in Sri Lanka - Gaurawa deposit scheme  Case Study 4: Caixa Economica Federal of Brazil - Turning income into savings and...
  • 32
  • 366
  • 0
Báo cáo khoa học: Coexpression, purification and characterization of the E and S subunits of coenzyme B12 and B6 dependent Clostridium sticklandii D-ornithine aminomutase in Escherichia coli potx

Báo cáo khoa học: Coexpression, purification and characterization of the E and S subunits of coenzyme B12 and B6 dependent Clostridium sticklandii D-ornithine aminomutase in Escherichia coli potx

... sequence of oraE to those of known PLPdependent aminomutases reveals the presence of a conserved PLP-binding site, a lysine residue at position 629, at the C-terminus of the OraE protein [11] The binding ... alone, OraS protein can be expressed in a soluble form However, the OraE and OraS proteins were coexpressed in an Fig The over-expression of oraS and oraE at different temperatures (A) Supernatant ... folding of the desired expressed protein can be improved at lower induction temperatures [8–10] As shown in Fig 1, the solubility of the overexpressed OraS and OraE increases with decreasing IPTG induction...
  • 5
  • 401
  • 0
Báo cáo sinh học:

Báo cáo sinh học: "Estimating rates and patterns of morphological evolution from phylogenies: lessons in limb lability from Australian Lerista lizards" ppsx

... studies of rapidly evolving characters Phylogenetic studies are only the beginning of integrative approaches to understanding evolution of body form in living taxa In addition to inferring the ... JJ: Rates and patterns in the evolution of snake-like body form in squamate reptiles: evidence for repeated re -evolution of lost digits and long-term persistence of intermediate body forms Evolution ... the rates of evolutionary change were actually much slower Clearly, there is considerable uncertainty in estimating these ages, which may influence estimates of rates Estimates of evolutionary rates...
  • 4
  • 272
  • 0
Báo cáo khoa học:

Báo cáo khoa học: " Pharmacokinetics and dosage regimen of ceftriaxone in E. coli lipopolysaccharide induced fever in buffalo calves" pot

... Effect of pyrogen induced fever on the pharmacokinetics of cefazolin in goats Indian J Pharmacol 1992 24,51 15 Saini SPS Effect of fever on pharmacokinetics and dosage regimen of amikacin in cow ... the pharmacokinetics and dosage of cefuroxime by endotoxin -induced fever in buffalo calves Vet Res Commun 1999, 23, 361-368 Dardi MS, Sharma SK, Srivastava AK Pharmacokinetics and dosage regimen ... 0.6, 0.8 and 1.0 µg/ml and using the values of β and of Table 2, the dosage regimen of ceftriaxone were V computed and are presented in Table A comparison of plasma levels of ceftriaxone in febrile...
  • 4
  • 291
  • 0
Báo cáo khoa học:

Báo cáo khoa học: " Efficacy of VP2 protein expressed in E. coli for protection against highly virulent infectious bursal disease virus" pot

... 2PV eht gniniatnoc rotcev gninolc OPOT ehT iloc E ocE lgB rotcev noisserpxe 2PV fo noitcurtsnoC rerutcafunam eht yb dednemmocer sdohtem eht gniwollof )ASU ,negortivnI( rotcev gninolc OPOT eht ni ... deifirup htiw dezinummi snekcihc fo ytilibani ehT ni 2PV fo noisserpxe eht gnirud gnidlof reporpmi ot eud sepotipe lanoitamrofnoc ton tub raenil tsniaga detcerid saw nietorp 2PV htiw dezinummi snekcihc ... snoisel lasrub gnirocS snoisel gnirocs rof detcelloc erew sasrub eht dna ,ytilatrom rof yliad derotinom erew snekcihc eht fo llA snoisel lasrub gnirocs rof desu erew dna slortnoc evitagen degnellahcnu...
  • 7
  • 520
  • 0
Báo cáo sinh học:

Báo cáo sinh học: "Trends in antibiotic susceptibility patterns and epidemiology of MRSA isolates from several hospitals in Riyadh, Saudi Arabia" doc

... with increased amounts of peptidoglycan, and the increased quantities of unprocessed D-Ala-D-Ala cause increased 'trapping' and 'clogging', resulting in higher vancomycin MICs of 8–16 µg/ml and ... recovery from males and 34.2% from females in Saudi Arabia Similarly, from the eastern province of Saudi Arabia, Bukharie & Abdelhadi[28] (2001) report 63% of MRSA isolation from males and 37% from ... according to NCCLS guidelines against all isolates to determine the susceptibility of these isolates to such antibiotics[25] The antibiotics tested included: gatifloxacin, gentamicin, linezolid,...
  • 11
  • 384
  • 0

Xem thêm

Từ khóa: cloning expression and purification of monoclonal antibodies in scfv fc formatcloning expression and purification of a thaliana ttlconstruction expression and purification of the chimericenzymescloning expression and purification of rvfv n and nsscloning expression and purification of a fragment of the p murina msgconstruction expression and purification of recombinant peptidesexpression and purification of mptpaexpression and purification of recombinant hsp20 in e colicloning expression and purification of wt p450pyr and its mutantscomposition fractions and structure of leaf protein from green biomasscloning protein expression and purificationreagents cell culture recombinant protein expression and purificationpotential and environmental concerns of ethanol production from sugarcane molasses in pakistanapolipoprotein e expression and purificationsimulation of methanol production from biomass gasification in interconnected fluidized bedsBáo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANQuản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninhNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Thơ nôm tứ tuyệt trào phúng hồ xuân hươngThiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khíSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXchuong 1 tong quan quan tri rui roNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtBÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIChiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015MÔN TRUYỀN THÔNG MARKETING TÍCH HỢP