Label free and reagentless electrochemical detection of microRNAs using a conducting polymer nanostructured by carbon nanotubes application to prostate cancer biomarker mir 141
Label free and reagentless electrochemical detection of microRNAs using a conducting polymer nanostructured by carbon nanotubes application to prostate cancer biomarker mir 141
... 165 Label- free and reagentless electrochemical detection of microRNAs using a conducting polymer nanostructured by carbon nanotubes: Application to prostate cancer biomarker miR- 141 H.V. Tran a, b, ... Cai et al., 2003). In this paper, we describe a label- free and reagentless miRNA sensor based on an interpenetrated network of carbon nanotubes and electroactive polymer. The nanostructured polymer ... GGUAGAAAUGGUCUGUCACAAU 5′ miR- 29b-1 Target (RNA) 23 44.8 3′ UUGUGACUAAAGUUUACCACGAU 5′ miR- 103 Target (RNA) 23 50.2 3′AGUAUC GGGACAUGUUACGACGA 5′H.V. Tran et al. / Biosensors and Bioelectronics...
- 6
- 298
- 0
Báo cáo hóa học: " Sensitive and molecular size-selective detection of proteins using a chip-based and heteroliganded gold nanoisland by localized surface plasmon resonance spectroscopy" pptx
... basic parts to the readily fabricated from off-theshelf materials that are reasonably stable, and its subse-quent application to simple and low-cost diagnostics.Optimization of heterolihanded ... thesensing analysis and drafted the manuscript. SL participated in thefabrication of the film. JY conceived of the study, and participated in itsdesign and coordination. All authors read and approved ... specificligand s of MPA and DT with different chain lenghs wereused to fabricate nanoholes on the gold nanoisland. Thethickness of the gold nanoisland and the ratio of heteroli-gand w ere optimize...
- 7
- 432
- 0
Báo cáo hóa học: " cDNA targets improve whole blood gene expression profiling and enhance detection of pharmocodynamic biomarkers: a quantitative platform analysis" ppt
... completed all of the extraction of total RNA from bloodsamples. BL provided project and sample management support. AL and MNcompleted the analysis of the SAHA data. MM assisted with the data analysis and ... probes generated by Ribo-SPIA amplificationperform better than using the standard cRNA m ethod of amplification and labeling. cDNA hybridization s havegreater intensity (low Scale Factor) and better ... analysis and participated in drafting and editing of the manuscript. SL completedthe analysis of the protocol selection study, participated in the analysis of the SAHA data and participated in...
- 12
- 585
- 0
Báo cáo y học: "omparative Efficacy and Tolerability of 5-Loxin® and Aflapin® Against Osteoarthritis of the Knee: A Double Blind, Randomized, Placebo Controlled Clinical Study"
... 1. Laila Impex R&D Center, Jawahar Autonagar, Vijayawada, 520 007, India 2. Department of Orthopedics, Alluri Sitarama Raju Academy of Medical Sciences (ASRAM), National Highway 5, Eluru, ... urine and whole blood of all subjects at each visit of the study duration. Serum biochemical parameters and hematological parameters were measured using an automated analyzer (HumaStar 300) and ... 325–344. 17. Lalithakumari K, Krishnaraju AV, Sengupta K, Subbaraju GV, Chatterjee A: Safety and toxicological evaluation of a novel, standardized 3-O-acetyl-11-keto-β-boswellic acid (AKBA)-enriched...
- 12
- 606
- 0
Tài liệu The and Social EffEconomic ects of Financial Liberalization: A Primer for Developing Countries pdf
... fi nancial deepening (measured by the ratio of fi nancial to real wealth) and in-creased fi nancial intermediation (measured by the share of fi nancial assets of fi nancial institutions in total ... economic organizations and also integrated areas of fi nan-cial activity earlier separated from one another to ensure transparency and discourage unsound fi nancial practices.2 DESA Working Paper ... while fi nancial liberalization does encourage new kinds of fi nancial savings, total domestic savings typically do not increase in many cases, and expansion of available fi nancial savings is often...
- 20
- 482
- 0
Tài liệu FUZZY CLUSTERING ALGORITHMS ON LANDSAT IMAGES FOR DETECTION OF WASTE AREAS: A COMPARISON pdf
... thermal infrared sixth band) and we analyzed several combinations of threebands. Among the possible combinations of Landsat bands, the most significant for our aimshave been:1. The bands 4, 5 and ... near Caserta(Italy), and the sp ecific goal was the discrimination and monitoring of caves and wastingareas present in the scene. In our case we use only six out of the seven available bands(we ... Landsat thematic mapper (TM)images acquired in May 1994, March 1997 and October 1997. The selected geographicalarea is located between Monte San Michele and Piana di San Marco Vecchio, near...
- 11
- 371
- 0
Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc
... infection, as assessed by the mitochondrial release of cytochrome c, caspase-9 and caspase-3 activa-tion, and DNA fragmentation. In an in vitro assay, intact ETA inducedADP-ribosylation of EF-2 and ... (h)AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDNALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGNQLSHMSPIYTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQTQPRREKRWSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRLHFPEGGSLAALTAHQACHLPLETFTRHRQPR2791ETA-B280GWEQLEQCGYPVQRLVALYLAARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVVSLTCPVAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWPETA -A LAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPPREDLK613 A BFig. ... Quantitative analysis of DNA fragmenta-tion after toxin-induced cell death was analyzed by immu-noassay determination of cytoplasmic histone-associatedDNA fragments, according to the manufacturer’s...
- 15
- 588
- 0
Báo cáo khoa học: Bridging the gap between in silico and cell-based analysis of the nuclear factor-jB signaling pathway by in vitro studies of IKK2 ppt
... gate-ways to NF-kappaB activation and transcription. Onco-gene 25, 6685–6705.26 DiDonato JA, Hayakawa M, Rothwarf DM, Zandi E& Karin M (1997) A cytokine-responsive IkappaBkinase that ... the oscillatorybehavior of nuclear factor (NF-jB) is coupled to free IkappaB kinase-2(IKK2) and IkappaBalpha(IjBa), and that the phosphorylation of IjBa by IKK influences the amplitude of NF-jB ... (1998)Recombinant IkappaB kinases alpha and beta are directkinases of Ikappa Balpha. J Biol Chem 273, 30736–30741. A. E. C. Ihekwaba et al. In vitro analysis of NF-jB signaling pathwayFEBS Journal 274...
- 13
- 475
- 0
Báo cáo khoa học: Selective detection of superoxide anion radicals generated from macrophages by using a novel fluorescent probe pdf
... lensspectrometry. Anal Chim Acta 250, 95–104.3 Yi XF & Ben GY (2000) Seasonal variation in antioxi-dants of Polygonum viviparum and its relation to solarradiation in alpine meadow. Acta Bot Boreal OccidentSin ... with an argon ion laser. Acquired images were analyzed using image-pro plus 4.5 software.Materialso-Aminobenzenothiol was purchased from Fluka (Shang-hai, China). A stock solution (1 mm) of ... 4,5-Dihydroxy-1,3-benzenedisulfonic acid disodium salt (Tiron) was fromShanghai Reagent Co. Ltd (Shanghai, China). All chemi-cals were of analytical reagent grade, and double-distilledwater was used throughout. RAW264.7...
- 9
- 401
- 0
Electrochemical Oxidation of Cysteine at a Film Gold Modified Carbon Fiber Microelectrode Its Application in a Flow—Through Voltammetric Sensor
... separation and detection of native amino acids and the identification of electroactive and non-electroactive analytes. J. Chromatogr. A 2002, 1095, 193–196. 29. Xiaomi, X.; Weber, S.G. Carbon ... peak height was calculated using a chromatogram data integrator (Scientific Information Service Corp., Davis, CA, USA). The samples of L-cysteine and hydrogen tetrachloroaurate(III) trihydrate ... chromatograms in Figure 12 (A C) are comparable to a chromatogram of cysteine at bare Au, Au/CFE and blank solution. The peak height of cysteine at Au electrode (retention time 7.49 min) is smaller...
- 16
- 371
- 0
Từ khóa: explain the process of photosynthesis using a diagramdetection of agreement and disagreementsynthesis and electrochemical performance of lifepo4 by solgel methodsynthesis and electrochemical performance of graphenepolyanilinesynthesis and electrochemical performance of graphenelike ws2detection of cocaine and its metabolites in breast milkchuyên đề điện xoay chiều theo dạngNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDEPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọPhát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Thơ nôm tứ tuyệt trào phúng hồ xuân hươngSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtBÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namQUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ