the property inspector defines the text field as input text the variable name is myurl and the show border button is selected a text field without a border bottom left appears on your stage in authoring mode with a dotted border a te
Báo cáo vật lý: "The Hidden Property of Arrhenius-type Relationship: Viscosity as a Function of Temperature" doc
... (L-shifted) to the right (R-shifted), shows an increasing slope value and a decreasing intercept value (Fig 4) Since the slope and intercept values relate to the Ea and the infinite-temperature viscosity, ... zero-, infinite-temperature viscosity, and the Ea, and the R-squared value was estimated 2.5 Shifting Experimental Data of Viscosity and Temperature to Investigate the Reliability of Ea in Indicating ... dynamic viscosity (Pa.s); A is the pre-exponential factor (Pa.s); Ea is the exponential constant that is known as activation energy (J/mol); R is the gas constant (J/mol/K) and T is the absolute temperature...
- 10
- 496
- 1
Báo cáo y học: "This Provisional PDF corresponds to the article as it appeared upon acceptance. Fully formatted PDF and full text (HTML) versions will be made available soon." ppsx
... a familiar form, mainly in young women in whom the disease is more aggressive and the prognosis is poor [1-4] On the basis of this distinction and on the stability of follow-up, the second patient ... resolution CT scan in patient no shows severe pleural and subpleural thickening with moderate fibrotic changes in the marginal parenchyma Traction bronchiectasis and honeycombing are also seen Fig Histological ... pattern of usual interstitial pneumonia (UIP), mainly due to the the absence of a caudocranial gradient However, the main localization of the abnormalities was in the upper lobes, which was is...
- 15
- 320
- 0
The phenomenon of evaporative cooling from a humid surface as an alternative method for air-conditioning
... characteristic in inadequately maintained installations, come from the material ported by the air or generated by the deterioration of the metallic elements in contact with water; but they mainly ... Legionnaire’s disease The bacteriological contamination, mainly by legionnaire’s bacteria, has become the main disadvantage of the evaporative cooling systems Therefore, this implies that in many ... humidified, gaining enthalpy c- Water is at the adiabatic saturation temperature of inlet air Air is cooled and humidified maintaining its enthalpy constant d- Water temperature is between the adiabatic...
- 28
- 652
- 0
Báo cáo khoa học: Identification of the N-terminal region of TjZNT2, a Zrt⁄Irt-like protein family metal transporter, as a novel functional region involved in metal ion selectivity ppt
... 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF TjZNT1 TjZNT2 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFA 74:LAGAAGVAIPLIGRNRRFLQTDGSLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPEFPWKKFPFPGFFA ... control cells, whereas a strain expressing DN36 showed no increase in manganese accumulation (Fig 5B) The strain expressing DN36 had an increased zinc content and measurement of the 65Zn uptake ... N-terminal regions of these proteins TjZNT2 possesses a 36 amino acid hydrophilic extension at the N-terminus (Fig 2), and has a second methionine at position 37 that is in a similar position...
- 8
- 343
- 0
báo cáo hóa học:" The PedsQL™ as a patient-reported outcome in children and adolescents with Attention-Deficit/Hyperactivity Disorder: a population-based study" pdf
... months, has your child had a chronic health condition?") defined as a physical or mental health condition that has lasted or is expected to last at least months and interferes with the child's activities ... These findings are consistent with PedsQL™ ADHD findings from The Netherlands [22] and Thailand [44] These multinational consistencies support the potential international generalizability of these ... include analyses of data for parent proxy-report for children ages 2–4 DataStat, a nationally-based survey administration firm located in Michigan, was contracted to administer the California SCHIP...
- 10
- 538
- 0
.The CFO as Business Integrator CEDRIC READ, HANS-DIETER SCHEUERMANN AND THE mySAP FINANCIALS potx
... advertising and promotional spend and we try to network this information across the organization as much as we can.” Diageo is one of the companies that has abandoned traditional budgeting in favor ... business software applications it is often misused, and this can lead to misunderstanding and confusion When considering information systems, integration typically refers to data integration and ... same format and has the same attributes as a “product” in the manufacturing system Standard data formats such as XML (extensible markup language) may ease the communication of a product master record...
- 385
- 518
- 0
Báo cáo khoa học: "Early results on the use of biomaterials as adjuvant to abdominal wall closure following cytoreduction and hyperthermic intraperitoneal chemotherapy" ppt
... resection Authors’ contributions CB assisted with acquisition of data and drafting the manuscript, PS assisted with revision of the manuscript, NJE assisted with study design and revision of the manuscript ... discharge was noted from the surgical incision and a decision for surgical reexploration was made Upon re-exploration, the previously placed Surgisis mesh was intact and easily dissected from the underlying ... enterocutaneous fistula wound discharge with associated with respiratory failure days after HIPEC necessitating reexploration Upon re-exploration, the integrity of the abdominal wall and gastrointestinal...
- 7
- 382
- 0
Báo cáo khoa học: "The stylomastoid artery as an anatomical landmark to the facial nerve during parotid surgery: a clinico-anatomic study" pptx
... head down position and an anaesthetic Valsalva manoeuvre is carried out Judicious haemostasis with cautery and ties is carried out before a large 'Haemovac' drain is carefully placed and the incision ... by histologically Intraoperative clinico-anatomical data included: origin of the stylomastoid artery (SMA), recording the usual position and any variation of the facial nerve (FN) and assessing ... Description of the surgical access to the stylomastoid artery (traditional cervico-mastoid-facial approach) The consented patient is placed under general anaesthesia (with hypotension if indicated) and...
- 5
- 312
- 0
báo cáo khoa học: "Acute abdomen due to spontaneous splenic rupture as the first presentation of lung malignancy: a case report" ppsx
... mmHg, heart rate of 72 beats per minute, saturations 97% on a nonrebreather mask and temperature of 36.9°C The admission examination revealed normal cardiac examination and bibasal inspiratory ... local oncologist and her case was discussed at the lung cancer multidisciplinary team meeting In view of the diagnosis and staging, a palliative treatment pathway was agreed from the outset and ... right paratracheal node Pneumococcal and meningococcal vaccines were administered and our patient was then promptly taken to theater for laparotomy On examination of her internal organs at laparotomy,...
- 4
- 347
- 0
Báo cáo y học: "Acquired hemophilia as the cause of lifethreatening hemorrhage in a 94-year-old man: a case report" pot
... contributor in writing the manuscript JR analyzed the patient data and contributed in writing the manuscript RP and BE analyzed and interpreted the patient data and were major contributors in writing the ... monitoring of his coagulation parameters On follow-up six weeks after discharge, his bradycardia had reversed and his heart rate had increased to 85 beats/minute, which suggests that the initial bradycardia ... [2], and no bypassing agent is immediately available, as was the case with our patient Autoantibodies can be very difficult to saturate with factor VIII concentrate due to the variability of inhibitor...
- 4
- 496
- 0
Báo cáo y học: "Acquired hemophilia as the cause of lifethreatening hemorrhage in a 94-year-old man: a case report" potx
... contributor in writing the manuscript JR analyzed the patient data and contributed in writing the manuscript RP and BE analyzed and interpreted the patient data and were major contributors in writing the ... monitoring of his coagulation parameters On follow-up six weeks after discharge, his bradycardia had reversed and his heart rate had increased to 85 beats/minute, which suggests that the initial bradycardia ... [2], and no bypassing agent is immediately available, as was the case with our patient Autoantibodies can be very difficult to saturate with factor VIII concentrate due to the variability of inhibitor...
- 4
- 397
- 0
Báo cáo y học: " Breast conserving surgery with preservation of the nipple-areola complex as a feasible and safe approach in male breast cancer: a case report" pptx
... 64:1583-1585 Authors' contributions SL and GF collected the data and reviewed the literature and case notes and was involved in followup appointments Furthermore, SL was involved in the active followup and ... of the patient SL wrote the paper with the assistance of GF RAM reviewed and edited the initial manuscript DJH performed the initial operation, and organised the primary management plan of the ... mammograms, breast US, bone scans and liver US showed no evidence of disease Eight years after the operation, the mammogram showed microcalcifications in the ipsilateral breast and he underwent diagnostic...
- 3
- 275
- 0
Nominalization as grammatical metaphor in political discourse in English and Vietnamese from the perspective of systemic functional grammar
... textual This thesis is an attempt to explore nominalization in English and Vietnamese in theory and in a specific political discourse in English and one in Vietnamese The analysis of nominalization ... exists and the meaning can now be treated as existing, as a kind of abstract thing Second, nominalization is available to function as a participant in another process, and also as Theme Furthermore, ... SUMMARY OF THE THESIS Halliday (199 8a) points out that grammatical metaphor of nominalization is as the main lexicogrammatical characteristic of the academic language Grammatical metaphor of nominalization...
- 15
- 540
- 6
The text doesn’t stop at the end of the page (or does it) an exploration of how the novel form responds to digital interactivity through the cross sited novel ‘once in a lifetime
... it was my flat and that as long as that washing machine was in my flat I’d be the one moving it and he protested, and then we were into this scene straight out of The Marathon Man and I was Laurence ... beer, as he was apparently wont to I was finally beginning to realise that I wasn’t any other of my other favourite songwriters or singers either I was me, and I was alone, and I had to deal with ... in his underpants, unwashed and unshaven with a can of creamy rice in one hand, a beer in the other and a bag of salt and vinegar chips clamped between his teeth, heading back to bed and to the...
- 317
- 311
- 0
GIẢI PHÁP VÀ KIẾN NGHỊ NHẰM PHÁT TRIỂN KINH DOANH THẺ QUỐC TẾ TẠI NGÂN HÀNG Á CHÂU.doc
... thương hiệu Visa Mastercard; thẻ ghi nợ Visa Electron Mastercard Electronic…Gần đây, ACB phát hành thêm sản phẩm thẻ ghi nợ quốc tế Visa Debit Mastercard Dynamic Đây bước tiến quan trọng chiến ... nơi an toàn - Không tiết lộ số thẻ mã số Pin, không để chung thẻ số Pin Không viết mã số Pin hay mật mã mở tài khoản thẻ - Phải nhận h a đơn máy in ra, không rút tiền - Theo dõi chặt chẽ h a đơn ... niên, phí thay thẻ, phí cấp Bảng thông báo giao dịch ) cao so với mức phí số ngân hàng khác Trong đó, ngân hàng thương mại ngày tham gia vào lĩnh vực kinh doanh đầy tiềm Như vậy, để cạnh tranh với...
- 13
- 690
- 5
Tình hình kinh doanh và giải pháp phát triển kinh doanh thẻ quốc tế tại ngân hàng Á Châu nói chung và ngân hàng Á Châu chi nhánh Tân Bình nói riêng.doc
... Tình hình kinh doanh thẻ quốc tế Việt Nam 19 2.1.4.1 Những kết đạt 19 2.1.4.2 Những khó khăn việc phát triển kinh doanh thẻ quốc tế Việt Nam 21 2.2 Tình hình kinh doanh thẻ quốc ... doanh thẻ quốc tế ACB 25 2.2.1.4 Kết kinh doanh thẻ quốc tế ACB 30 2.2.2 Tình hình kinh doanh thẻ quốc tế ngân hàng Á Châu chi nhánh Tân Bình .33 2.3 Phân tích đánh giá tình hình kinh ... Việt Nam năm 2007 31 Biểu đồ 2: Sự tăng trưởng thẻ quốc tế nội đ a qua năm .32 Biểu đồ 3: Doanh thu từ thẻ quốc tế ACB 33 LỜI NÓI ĐẦU Trong năm gần đây, kinh tế Việt Nam đà...
- 10
- 711
- 6
Nghiên cứu các biến số ảnh hưởng đến lòng trung thành của khách hàng thẻ ATM tại ngân hàng Đông Á.doc
... Eximbank, MB ) Liên minh Banknetvn Agribank chủ trì kết nối bảy ngân hàng Agribank, BIDV, Saigonbank, Viettinbank, ABBank, MHB, Habubank Ngoài có liên minh thẻ Sacombank ANZ Tuy nhiên, đầu tư ... Việt Nam Hiện toàn thị trường có bốn liên minh thẻ lớn liên minh VNBC (DongA Bank, MHB, Saigonbank, Habubank), liên minh Smartlink gồm 20 thành viên (Vietcombank, VIB Bank, VP Bank, OCB, Eximbank, ... (Parasuraman et al., referred to in Caruana, 2002) - Sự thoả mãn khách hàng Sự thoả mãn thứ có trước lòng trung thành Trong môi trường kinh doanh cạnh tranh cao, thoả mãn khách hàng yếu tố quan...
- 78
- 1,732
- 31
Báo cáo y học: "Aplasia and Agenesis of the Frontal Sinus in Turkish Individuals: A Retrospective Study Using Dental Volumetric Tomograph"
... hormones, and craniofacial configuration) and environmental (climatic conditions and local inflammations) factors control the frontal sinus configuration within each population and contribute ... cells extending above a line tangential to the supraorbital margin (horizontal line) Frontal sinus aplasia is also defined by an oval-shaped sinus with the lateral margin medial to a vertical line ... light was centered at the level of the sinus, indicating the optimized center of the reconstruction area In addition, the head position was adjusted in such a way that the hard palate was parallel...
- 5
- 577
- 0
Tìm thêm: xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 sự cần thiết phải đầu tư xây dựng nhà máy phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25