structure of the gastrointestinal gi tract figure 6 1
Báo cáo khoa học: "Mantle cell lymphoma of the gastrointestinal tract presenting with multiple intussusceptions – case report and review of literature" docx
... Journal of Surgical Oncology 2009, 7 :60 10 11 12 13 14 15 16 17 18 19 20 21 22 Laws HL, Aldrete JS: Small-bowel obstruction: a review of 465 cases South Med J 19 76, 69 (6) :733-4 Stewardson RH, Bombeck ... Blood 19 94, 84 :1 3 61 -13 92 Cornes JS: Multiple lymphomatous polyposis of the gastrointestinal tract Cancer 1 9 61 , 14 :249-257 Page of (page number not for citation purposes) World Journal of Surgical ... analysis of MCL shows rearrangement of the bcl -1 locus on chromosome 11 due to t (11 :14 ) (q13:q32) translocation, accompanied by cyclin D1 antigen overexpression [15 ] Figure 10 field Cytological...
- 6
- 476
- 0
Báo cáo y học: "Proteinase-activated receptor-2: two potential inflammatory mediators of the gastrointestinal tract in Atlantic salmon" ppt
... SBM 794.6a 11 1 87 322a 463 b 10 0 10 9 700c 14 4 15 0 5.0 490c 300d 10 0 10 5 3.5 924 14 2.5 62 9.8 11 0.3 29.4 13 1.9 914 15 8.5 465 .6 1 16 . 0 11 0.4 81 .6 935 .6 248.9 510 .9 1 16 . 3 945 .6 17 4.2 519 .1 108 .6 (Egersund ... AF3 218 36 AF3 218 36 AF 012 125 AF 012 1 26 BU693999 BU693999 AJ42 762 9 AJ42 762 9 PAR-2F PAR-2R_Deg PAR-2a_RACE_F1 PAR-2a_RACE_R1 PAR-2b_RACE_F1 PAR-2b_RACE_R1 PAR-2a_RT_F1 PAR-2a_RT_R1 PAR-2b_RT_F1 PAR-2b_RT_R1 ... PAR-2b_RT_R1 SS-EF1-alpha F1 SS-EF1-alpha R1 SS beta-aktin F1 SS beta-aktin R1 GAPDH F1 GAPDH R1 SS -18 SrRNA F1 SS -18 SrRNA R1 PCR annealing temperature (C°) PCR product size (bp) 58 14 9 68 13 16 * 739* 16 5 5*...
- 12
- 278
- 0
THE structure of the multiprogramming system
... venVolume 11 / Number / May, 1 968 ture the opinion that the larger the project, the more essential the structuring! A hierarchy of five logical levels might then very well turn out to be of modest ... from the picture At level we find the "message interpreter" taking care of the allocation of the console keyboard via which conV o l u m e 11 / N u m b e r / May, 1 968 versations between the operator ... been introduced and inigiahzed begin semaphore mutex; mutex := 1; parbegin begin L1 : P (mutex) ; critical section 1; V (mutex) ; remainder of cycle 1; go to L1 end; begin L2: P mutex); critical...
- 6
- 713
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 – insights into the enzyme mechanism and stability pdf
... 73 265 9 12 463 1 6. 1 (5.2) 16 . 6 (3 .6) 18 .3 36. 13 1. 57 (1 . 61 1. 57) 987 31 (65 89) 19 .8 (33.7) ⁄ 23 .6 (35.9) 0.008 1. 135 69 84 29 63 0 31. 86 1. 35 (1. 38 1. 35) 15 29 91 (10 838) 18 .8 (23.9) ⁄ 20.3 (25.4) 0.008 1. 170 ... (°) D 16 5 -M-H79 H79-M-H 16 9 H79-M-wata Wata-M-H 16 9 H 16 9 -M-D 16 5 H 31- M-D 16 5 H 31- M-watb a Fe 0. 06 ± 0. 01 0.03 ± 0.02 0.04 ± 0.03 10 4.8 ± 1. 3 1 36. 1 ± 0.8 97.2 15 1.5 77 .1 74.5 11 1 .1 82 .1 16 9 .5 11 8.8 ... 91. 81 50.0 1. 35 (1. 40 1. 35) 1. 94 4.8 ( 36. 1) 98.0 (97.0) 11 79 512 16 4 370 7.3 (6. 9) 15 .9 (5.8) 13 .8 a = 69 . 06 b = 71. 76 c = 76. 40 b = 91. 72 50.0 1. 48 (1. 53 1. 48) 1. 92 7.7 (38.3) 95.9 (88.9) 73 265 9...
- 12
- 762
- 0
Tài liệu High-level Expert Group on reforming the structure of the EU banking sector docx
... IE 31 12.9 87 .1 1 ,19 3 32.0 68 .0 IT 67 86. 6 13 .4 2,794 91. 5 8.5 LT 19 21. 1 78.9 24 9.9 90 .1 LU 14 1 7 .1 92.9 795 7.9 92 .1 LV 28 42.9 57 .1 26 37.7 62 .3 MT 26 38.5 61 .5 52 20.2 79.8 NL 92 31. 5 68 .5 ... 9 .1 1, 16 6 74.9 25 .1 BE 17 58.8 41. 2 1, 147 48.5 51. 5 BG 31 25.8 74.2 39 23.5 76. 5 CZ 38 13 .2 86. 8 16 8 5 .1 94.9 CY 39 15 .4 84 .6 12 5 68 .4 31 .6 DE 1, 737 95.3 4.7 7,9 96 94.8 5.2 DK 11 3 95 .6 4.4 920 ... 88.8 11 .2 PL 64 0 91. 9 8 .1 297 36. 2 63 .8 PT 10 9 50.5 49.5 513 77.8 22.2 RO 39 17 .9 82 .1 84 16 . 7 83.3 SE 23 87.0 13 .0 1 , 61 8 99 .6 0.4 SI 21 47 .6 52.4 53 72 .6 27.4 SK 30 13 .3 86. 7 55 11 .0 89.0 UK 17 7...
- 153
- 448
- 0
Tài liệu Báo cáo khoa học: Structure of the putative 32 kDa myrosinase-binding protein from Arabidopsis (At3g16450.1) determined by SAIL-NMR docx
... atoms of residues 15 3–297 (C-domain) 95.5 97.8 93.3 19 82 11 92 11 1 67 9 0 .18 13 8 1 36 2 .6 12 4 1. 77 ± 0. 56 )7508 ± 21 )2239 ± 30 89.0 9.5 1. 0 0.5 1. 12 ± 0 .19 1 .65 ± 0. 16 0 .69 ± 0 .10 1. 08 ± 0.09 a The ... At3g 16 4 50.1C MBPfromB.napus1 -12 5 MBPfromB.napus194-3 36 MBPfromB.napus3 56- 498 At1g52030.2 -15 4 At1g52030. 16 1 -289 At3g 16 4 00.2 -14 2 At3g 16 4 40.2 -14 4 At3g 16 4 40 .15 4-300 At3g 16 4 70.2 -14 5 At3g 16 4 70 .15 8-297 ... LEGGTEFVLEK-KDHKIVGFYGQAG-EYLYKLGVNVAPIANKTRNQFSIHAPKDNQIAGFQGISS-NVLNSIDVHFA MBPfromB.napus1 -12 5 MBPfromB.napus194-3 36 MBPfromB.napus3 56- 498 At1g52030.2 -15 4 At1g52030. 16 1 -289 At1g52030.3 36- 4 76 At3g 16 4 00.2 -14 2 At3g 16 4 40.2 -14 4 At3g 16 4 40 .15 4-300 At3g 16 4 70.2 -14 5...
- 12
- 579
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the catalytic domain of DESC1, a new member of the type II transmembrane serine proteinase family pptx
... angles (°) P 212 12 a ¼ 47.9 b ¼ 70.2 c ¼ 80.2 a ¼ b ¼ c ¼ 90° 1. 54 20 1 .6 98 .1 (89.8) 0.079 (0 .1 86) 4 .6 (2 .1) 20 1 .6 19 30 13 0 21. 13 (24.3) 22 .14 ( 26. 4) 29853 ⁄ 15 56 28.39 0.005 415 1. 367 07 Crystallographic ... planes of the bonds between Trp 215 –Gly2 16 and Cys1 91 Gln192 sandwich the phenyl ring of benzamidine The DESC1 S1 pocket resembles the thrombin S1 pocket type because of the presence of an Ala rather ... [1, 2 ,10 ] S1 The following segments border the S1-specificity pocket of DESC1: Asp189–Gln192 (the basement of the pocket), Ser 214 –Gly 219 (the entrance frame), Lys224– Tyr228 (the back of the pocket)...
- 13
- 588
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the BcZBP, a zinc-binding protein from Bacillus cereus doc
... with the Nd atom of His12, one of the Od atoms of Asp15 and the Ne atom of His 113 His 113 protrudes from helix a4 whereas His12 and Asp15 both belong to the loop which joins the b1strand with the ... Ile18, Ile149, Leu172, Phe179 and the aromatic ring of Tyr194 The side chains of Tyr194, Asn150 and Asp108 form a hydrophilic patch close to the zinc ion and to the His 110 ⁄ Asp 112 pair This position, ... with the same residues coordinating a zinc ion These residues plus an additional conserved motif (Fig 7B) in the immediate neighborhood of the active site (His 110 , Pro 111 , Asp 112 , His 113 in the...
- 11
- 710
- 0
Tài liệu Báo cáo khoa học: Spectroscopic characterization of a higher plant heme oxygenase isoform-1 from Glycine max (soybean) ) coordination structure of the heme complex and catabolism of heme docx
... 405 12 7 428 415 420 414 8.2 500, 63 0 402 12 8 557 427 5 41, 578 410 539, 569 427 539, 577 427 8.9 498, 63 1 404 14 0 555 4 31 537, 574 410 5 36, 566 419 537, 575 414 7 .6 500, 63 1 554 540, 575 535, 568 ... GmHO -1 SynHO -1 rHO -1 Alkaline Low spin g1 g2 g3 15 NO a (15 N), G a (14 N), G g1 g2 g3 Neutral Alkaline -1 Alkaline-2 2 .63 2. 21 1.82 2. 86 2.29 1. 59 2.78 2 .14 1. 74 2 .68 2.20 1. 80 27 7 .6 2.09 2. 01 1. 96 ... properties of a FEBS Journal 273 (20 06) 5384–5399 ª 20 06 The Authors Journal compilation ª 20 06 FEBS 5397 Heme catabolism by soybean heme oxygenase -1 10 11 12 13 14 15 16 17 18 19 20 21 22 T Gohya...
- 16
- 617
- 0
Tài liệu Báo cáo khoa học: Unusual metal specificity and structure of the group I ribozyme fromChlamydomonas reinhardtii23S rRNA pptx
... cleavage at the FEBS Journal 273 (20 06) 263 1 264 4 ê 20 06 The Authors Journal compilation ê 20 06 FEBS Mn2+ inhibition and structure of Cr.LSU ribozyme T.-C Kuo et al Ct 1. 5 10 25 60 1. 5 10 20 40 60 Fig ... 19 , 66 1 16 6 18 24 Holloway SP & Herrin DL (19 98) Processing of a composite large subunit rRNA: studies with Chlamydomonas mutants decient in maturation of the 23S-like rRNA Plant Cell 10 , 11 9 312 06 ... us to study the global tertiary structure of the intron using FEBS Journal 273 (20 06) 263 1 264 4 ê 20 06 The Authors Journal compilation ê 20 06 FEBS 263 5 Mn2+ inhibition and structure of Cr.LSU ribozyme...
- 14
- 480
- 0
Tài liệu Báo cáo khoa học: Proton transfer in the oxidative half-reaction of pentaerythritol tetranitrate reductase Structure of the reduced enzyme-progesterone complex and the roles of residues Tyr186, His181 and His184 pdf
... H184A PETN reductase Y186F PETN reductase 35 0.34 0.49 14 9.5 19 .2 44 2 .1 4.5 9.3 15 .8 6. 9 78.4 19 4 13 4 16 4 a ± ± ± ± 0. 01 0.02 ± ± ± ± 1 .6 1. 5 0.2 ± ± ± ± 0 .1 0.4 0.3 0.3 ± ± ± ± 11 .7 27 11 ... reductase H181A PETN reductase H184A PETN reductase Y186F PETN reductase 466 2 5.4 92 73 11 ± ± ± ± 2,4-Dinitrophenol 1. 1 12 16 Progesterone 0.95 56 34 1. 9 0.07 16 15 0.05 ± ± ± ± 0 .10 0.5 ± ± ... the Y186F mutant displayed in blue A B 17 11 13 O R 12 16 10 14 15 O C Progesterone O O NADPH + H+ O NADP+ O Fig Structure of the reduced PETN reductase-progesterone complex (A) Active site of...
- 12
- 603
- 0
Tài liệu Báo cáo khoa học: Solution structure of the matrix attachment region-binding domain of chicken MeCP2 ppt
... F1 56( 15 5)I,S,C; D157 (1 56) G,E; F158 (15 7)I; T159 (15 8) M,A; and G 16 2 ( 16 1 )R,W (here and in the discussion below, human numbering is given in parentheses) F1 56( 15 5), D157 (1 56) , and F158 (15 7) are conserved ... P153 and G 16 2 are buried in the protein core Also, F1 56, F158, and V 16 0 are tightly packed into the hydrophobic core of the domain On the other hand, residues D152, N154, D155, D157, and R 16 3 are ... charged arginines [or the bulky tryptophan in the case of G 16 2 ( 16 1 )W] is predicted to generate gross structural disturbance of the fold Likewise, as the side chains of F1 56( 15 5) and F158 (15 7) contribute...
- 8
- 466
- 0
Tài liệu Báo cáo khoa học: The structure of the carbohydrate backbone of the lipopolysaccharide from Acinetobacter baumannii strain ATCC 19606 docx
... 72.4 77.3 76. 7 76. 7 76. 7 70.7 70.4 63 .2 63 .2 73.3 73.3 72.8 72.8 70.0 69 .2 71. 0 71. 0 17 7.3 17 5.0 16 9 .0 16 8 .7 61 .9 61 .3 61 .8 61 .4 60 .8 60 .8 59.7 60 .6 61. 1 61 .1 61 .7 61 .4 61 .4 61 .5 B, b-GlcpN C, a-Kdo ... 91. 7a 91 .6 10 0.2 10 0.4 17 5.9 1 76. 1 1 76. 0 1 76. 0 18 2.4 18 2.0 1 76. 0 1 76. 0 97.0 97 .6 91. 8 92.2 98.3 96. 7 10 2.2 10 2.2 10 3.2 10 3 .1 103.5 10 2.2 98.2 98.2 10 0.4 10 3.3 98.2 98 .1 55.4b 55.4 56. 4 56. 4 10 0.8 ... 3. 86 10 3.82 3.83 10 2. 31 3 .63 3.74 3.75 4 .12 3.72 3.73 3.72 12 3.73 12 3.38 3.39 4.24 1. 9 4. 26 3 .65 3 .68 3.93 4.47 3.95
- 9
- 428
- 0
Tài liệu Báo cáo Y học: Structure of the O-polysaccharide and classification of Proteus mirabilis strain G1 in Proteus serogroup O3 potx
... 4 .12 4.03 3.70 3.85 3.78, 3.78 3.89, 4. 16 10 2.4 10 2.8 52.3 53.2 81. 3 71. 1 69 .0 75.9 76. 1 73.4 62 .4 66 .7 4.53 5.20 3. 36 3. 86 4.38 3. 56 4.05 1. 79, 1. 91 3.73 4.30 1. 43 3. 76 4. 96 1 .68 3.00 10 5.5 10 0.9 ... 2 56 000
- 7
- 465
- 0
Tài liệu Báo cáo Y học: Solution structure of the mEGF/TGFa44250 chimeric growth factor doc
... Glu43 Gly 36 O O O O O O Og O O Og O O O O O Og O O O O O O O O O O O O 0.7 96 6. 013 4 .17 7 3.958 2 .62 5 2. 262 2. 560 2.594 2.9 01 2.939 3.027 6. 594 0.247 5.443 3.853 0.377 0.793 4 .17 4 8 .10 7 1 .64 6 3.777 ... Superimposition of the backbones of 3egf and 1eph gave an rmsd of 0. 16 9 nm for residues 6 33 and 0. 16 5 nm for residues 32–47 The overall best structure from the chimera family was superimposed with a structure ... calculated structures also explain the large secondary structural shifts of Asn 16 bCH2 and Arg 41 gCH2, which Fig Stereo view of the of the 10 best chimera structures, superimposed using the backbones of...
- 9
- 488
- 0
Báo cáo khoa học: Flexibility and communication within the structure of the Mycobacterium smegmatis methionyl-tRNA synthetase Henrik Ingvarsson and Torsten Unge potx
... 2X1L) M smegmatis MetRS:M (PDB ID: 2X1M) 1. 038 30.0–2.3 (2.42–2.30) 384352 (5 067 1) 933 06 (13 3 81) 4 .1 (3.8) 97.8 ( 96. 1) 11 .8 (3.2) 9.3 (38 .1) 5 .1 ( 21 .6) 1. 038 20.0–2.8 (2.95–2.80) 1 16 0 80 ( 16 9 11 ) ... 1 16 0 80 ( 16 9 11 ) 15 16 4 (22 21) 7.7 (7 .6) 98.7 (99.4) 17 .8 (5 .1) 8 .6 ( 36. 3) 3.3 (13 .9) 61 .1 3.2 C2 a = 15 5.9, b = 13 8.9, c = 12 3.3 a = c = 90, b = 12 4.8 0. 81 54.4 2.7 R32:H a = 210 .0, b = 210 .0, c = 73.9 ... = b = 90, c = 12 0 0.57 30.0–2.3 8 863 4 467 0 21. 8 24.9 12 263 484 20.0–2.8 14 405 7 56 21. 0 24.9 412 0 16 23.8 47.0 15 .5 42.2 32.2 23 .1 24.2 28.9 – 46. 1 41. 2 31. 8 0.0 06 0.89 0.005 0. 81 Rmerge = RhRl...
- 16
- 514
- 0
Báo cáo khoa học: Structure of the atrial natriuretic peptide receptor extracellular domain in the unbound and hormone-bound states by single-particle electron microscopy ppt
... Chem 279, 61 15 61 23 13 De Lean A, McNicoll N & Labrecque J (2003) Natriuretic peptide receptor A activation stabilizes a membrane-distal dimer interface J Biol Chem 278, 11 159 11 16 6 14 van den ... Commun 1 16 , 69 6–703 Itoh H, Pratt RE & Dzau VJ (19 90) Atrial natriuretic polypeptide inhibits hypertrophy of vascular smooth muscle cells J Clin Invest 86, 16 9 0– 16 9 7 Chrisman TD & Garbers DL (19 99) ... inactive and the hormone-activated states of the receptor, respectively [13 ,14 ] It is hypothesized that a hormone-induced rearrangement of the ECD from the hh to the tt dimer structure brings the juxtamembrane...
- 9
- 450
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008