project gsea gene set enrichment analysis version 2 0 1 broad institute was first used to investigate how the physiological pathways and processes of hyperplastic liver might differ from liver carcinoma over the course of liver tumorigen
DECONTAMINATION OF CHEMICAL WARFARE SIMULANTS USING ELECTROSPUN MEDIA
... δ 60. 1 (C-6), 72. 2 (C-5), 72. 7 (C-3), 73 .2 (C -2) , 81. 7 (C -2 ), 82. 4 (C-4), 82. 8 (C-4’), 99 .2 (C -1 ), 10 1 .1 (C -1) , 1 02 . 7 (C-I), 12 7 .1, 13 1 .2, 13 1.4, 1 40. 0, 14 5.4 (5 x C-Ar), 1 62. 2 (CO) IR analysis ... functionalities 0. 9 0. 8 0. 7 CD Absorbance 0. 6 IBA 0. 5 IBA and CD 0. 4 CD derivative 0. 3 0 .2 0. 1 0 20 40 60 Time 80 10 0 1 20 Figure3.6: Change in the absorbance (at 4 10 10 nm) for the first 10 0 minutes The ... density of the nucleus 1 .2 Absorbance 0. 8 CD IBA 0. 6 IBA and CD CD derivative 0. 4 0 .2 0 20 0 400 600 800 10 0 0 1 20 0 Time Figure 3.5: Change in absorbance (4 10 10 nm) for 15 hours 34 O Chapter –III The...
- 167
- 573
- 0
Báo cáo y học: " Use of Non-parametric Item Response Theory to develop a shortened version of the Positive and Negative Syndrome Scale (PANSS)" potx
... PANSS 19 22 20 23 21 24 10 22 25 10 11 23 26 11 13 24 28 12 14 25 29 13 15 26 30 14 16 27 32 15 17 28 33 16 18 29 34 17 20 30 35 18 21 31 37 Note Total scores on the Positive subscale for the 19 -item ... 0. 048 0. 9 62 0. 005 Positive 19 .43 (6. 60) 19 .57 (6. 80) - 0. 9 61 0. 373 - 0. 02 1 Negative 22 . 70 (6. 92) 22 . 71 (6.93) - 0. 049 0. 9 61 - 0. 0 01 General 40. 82 ( 10 . 09) 40. 85 ( 10 . 14 ) - 0. 1 42 0. 887 - 0. 003 Total ... Original PANSS 19 20 45 23 21 47 25 22 49 10 27 23 51 11 29 24 52 12 30 25 54 13 33 26 56 14 34 27 58 15 36 28 60 16 38 29 62 17 40 30 64 18 41 31 66 19 43 32 67 Note The 30- Item General Psychopathology...
- 63
- 460
- 0
Tài liệu USE OF INTERPRETERS FOR NON-ENGLISH SPEAKING PERSONS pdf
... 20 08 , as follows: USE OF INTERPRETERS FOR NON-ENGLISH SPEAKING PERSONS INTRODUCTION Pursuant to the inherent powers of the Court and the Georgia Constitution of 19 83, and in order to secure the ... discipline to be imposed should depend upon factors such as the seriousness of the violation, the intent of the interpreter, whether there is a pattern of improper activity, and the effect of the improper ... disclosed at the request of the interpreter The Supreme Court of Georgia recognizes the actions of the Commission, the Administrative Office of the Courts, the Special Masters, the above-described...
- 22
- 615
- 2
Use of an extension of the park's transformation to determine control laws applied to a non sinusoidal permanent magnet synchronous motor
... motor has been modelled through a finite element code 16 1 Stator phases being not supplied, the fluxes induced in this stator phases ; " ; ; have-been computed (figure 2) : 1 ~ 10 0 21 0 24 0 ... the same time and the torque can be estimated to: Figure Rotor fluxes in the stator phases and their variations vs the position of tlie rotor 'fie scheme of a torque control is shown on figure ... pC "0) which defmes "pseudo d q " axes, so that @Ird = 0. As io = , the expression of the torque of the motor will be nearly the same as the expression for a sinusoidal drive: T, = p.@', (0) i, ( 10 ) ...
- 6
- 438
- 2
Báo cáo khoa học: "Unsupervised Recognition of Literal and Non-Literal Use of Idiomatic Expressions" potx
... 1 42 1 50 5 21 21 5 1 40 25 5 5 32 4 70 27 2 1 72 12 5 54 31 02 all 25 14 4 16 6 46 5 41 903 15 7 26 2 566 15 478 28 1 175 12 6 61 3964 Table 1: Idiom statistics (* indicates expressions for which the literal usage ... Fl CForm 78 .25 - Rep 79 .06 70. 00 5.96 10 . 98 Graph 79. 61 52. 21 67.87 59. 02 LC 80. 50 62. 26 26 . 21 36. 90 LC-O 80. 42 53.89 69 .03 60. 53 Super 95.69 84. 62 96.45 90. 15 Table 2: Accuracy, literal precision ... the trigger* rock the boat set in stone spill the beans sweep under the carpet swim against the tide tear one’s hair out all literal 16 39 20 688 17 34 11 8 62 non-literal 25 1 42 1 50 5 21 21 5 14 0...
- 9
- 391
- 0
Báo cáo khoa học: "Use of soft X-radiography for early non-destructive detection of floral differentiation in Douglas fir buds" pptx
... represents about 12 to the LD about , 50 20 00 0 rads for seeds, or to the doses used to induce mutagenesis in apple or pear buds (2 00 0 to 00 0 rads) Improvements in the definition of radiographs ... J Bot 4, 10 3 9- 10 4 9 Owens JN, Smith FH (19 64) The initiation and early development of the seed cone of Douglas fir Can J Bot 42, 10 3 1- 10 4 7 Simak M, Gustafsson A (19 53) X-photography and sensibility ... giving 20 - 40 buds) were collected about once every weeks (July 22 for tree number 1, July 31 for trees 1- 5, August 13 for trees 1- 5, August 22 for trees 1- 3, August 26 for trees and 5, and September...
- 9
- 241
- 0
Báo cáo y học: " Gender-specific profiles of tobacco use among non-institutionalized people with serious mental illness" ppsx
... 12 . 1 47.8 12 . 4 46.9 11 .9 1 .0 ( 719 ), p = 336 Somatic symptoms Depression 10 . 8 12 . 0 4.3 5.4 10 . 6 11 .5 4 .1 4.9 11 .1 12 . 8 4.6 -1. 6 (566 .1) , p = 10 0 3 6 .0 -3 .1 ( 522 .4), p = 0 02 3 Anxiety 11 .8 5.3 11 .3 ... 719 ) 18 .9 (3), p = < .00 1 159 22 .1 92 21. 5 67 23 .0 Married (spouse or common law partner) 79 11 .0 30 7 .0 49 16 .8 Widowed 28 3.9 17 4 .0 11 3.8 513 71 .0 1 02 14 .1 27 9 81 64.6 18 .8 23 4 21 80. 4 7 .2 ... 23 2 31. 8 11 9 27 .3 11 3 38.6 8.8 31 7 .2 32 11 .2 653 91 .2 399 92. 8 25 4 88.8 3.9 17 4 .0 11 3.8 688 96 .1 4 12 96 .0 27 6 96 .2 Yes 92 12 . 8 48 11 .2 44 15 .3 No 625 87 .2 3 82 88.8 24 3 84.7 Any Alcohol Intoxication...
- 12
- 244
- 0
báo cáo khoa học: " Non-medical use of opioids among HIV-infected opioid dependent individuals on opioid maintenance treatment: the need for a more comprehensive approach" docx
... -0 .24 ( -0. 45; 0. 00) -0. 13 ( -0. 39; 0. 08) 0. 15 ( -0. 07; 0. 40) 0. 91 (0. 67; 1 . 20 ) 0. 45 (0 .29 ; 0. 62) 0. 62 (0. 44; 0. 81) 0. 98 0 . 20 -3 < 10 0 .03 0 .22 0 . 20 -3 < 10 -3 < 10 -3 < 10 -0 .24 ( -0. 49; -0. 01) -0. 68 ... (6 .0) 666 (63 .2) 20 4 (19 .3) 16 [13 - 20 ] 11 [8 -13 ] 13 8 12 5 22 20 0 12 2 15 4 11 1 72 18 9 21 0 95 11 5 15 6 1 50 Coefficient (95 % CI) p-value 0. 00 ( -0. 41; 0. 37) 0. 16 ( -0. 09; 0. 39) -0. 69 ( -0. 96 ; -0. 43) -0 .24 ... -0. 01) -0. 68 ( -1. 17; -0 .28 ) 0. 34 (0. 18 ; 0. 52) 0. 81 (0. 56; 1 .07 ) -0. 56 ( -0. 86; -0. 32) -1 .00 ( -1. 35; -0. 76) 0. 06 0. 003 -3 < 10 -3 < 10 -3 < 10 -3 < 10 < 10 0 .03 0 . 20 -3 < 10 0 . 01 0. 06 16 [7- 30] 366 (34.9)...
- 23
- 215
- 0
Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt
... 10 4 AAAA < 10 20 UUAA < 10 80 AAUU x 10 5 x 10 4 UAAU x 10 4 x 10 3 AUUA x 10 6 10 UUUA x 10 5 < 10 AAAU AAUA No added receptor x 10 5 x 10 4 x 10 6 30 < 10 20 Figure of Analysis human/hamster Xpr1 chimeras ... ETGLGCRTPGGRKRARTFDFYVCPGHTVPTGCGGPREGYCGKWGCETTGQAYWKPSSSWDLISLKRGNTP 1 60 1 60 15 6 15 6 NZB AKR6 1E FrMCF 1 70 1 80 1 90 20 0 21 0 22 0 23 0 24 0 KDQGPCYDSSV-SSGVQGATPGGRCNPLVLEFTDAGRKASWDAPKVWGLRLYRSTGADPVTRFSLTRQVLNVGPRVPIGP ... secondary antibody 83A25 + secondary antibody 90 60 30 1 50 CHO/AAAU cells 1 20 90 AKR6 + 83A25 + secondary antibody 83A25 + secondary antibody 60 30 10 10 0 1 ,00 0 The 1E-pseudotype vector could only utilize...
- 12
- 227
- 0
common errors in the use of the english passive made by the grade 10 non-english majors at tran phu specialised high school, hai phong = những lỗi thường gặp ở thể bị động của học sinh không chuyên khối 10
... 10 B c d e 10 % 45% 85% 50% 20 % 15 % 55% 80% 40% 30% 25 % 50% 10 % 6% 80% 25 % 17 % 85% 60% 70% 60% 5% 5% 60% 60% 28 % - 5% 0% 24 % 0% - - Table 10 : Survey questionnaire results 2. 2 Data analysis 2. 2 .1. Students’ ... 45% 67% 80% 90% 30% 10 0 % 20 % 95% 40% 10 0 % 97% - 58% 77% 70% 97% 74% 67% 37% 11 % 72% 56% 60% 65% 51% 12 % 87% 40% 60% 45% 34% 56% 70% - 40% 67% 48% 34% 37% 39% 41% - Table 2: The statistic of correct ... for the study is also presented here 31 CHAPTER III – DATA PRESENTATION AND DISCUSSION Written test 1. 1 Written test result (Number of students: 70) Part Item I II III IV 10 11 12 13 14 15 10 0 %...
- 62
- 960
- 4
AN INVESTIGATION INTO THE USE OF ROLE PLAY FOR ENHANCING THE SECOND YEAR NON- ENGLISH MAJOR STUDENTS’ SPEAKING PERFORMANCE AT HANOI UNIVERSITYOF BUSINESS AND TECHNOLOGY Nghiên cứu về việc sử dụng đóng vai tình huống để nâng cao khả năng nói tiếng Anh của
... 15 CHAPTER 2: RESEARCH METHODOLOGY 17 2. 1 Background of the study 17 2. 1. 1 The teaching and learning context 17 2. 1 .2 The syllabus 17 2. 1. 3 The description ... help to build up a professional standard of language needed to communicate in the modern business world 18 2. 1. 4 The learners Generally, the students at HUBT age from 18 to 22 and the number of ... 10 1 .2. 3 Benefits of role play in teaching speaking 12 1 .2. 4 The teacher’s roles in role play activities 12 1 .2. 5 The learners’ roles in role play activities 14 1. 3 Review of...
- 84
- 875
- 0
The relationship between the use of vocabulary learning strategies and learner autonomy of the first year non-major English students at Thainguyen University of Technology
... Cliffs, NJ: Prentice Hall 31 Sert, N ( 20 06 ) EFL student teachers’ learning autonomy The Asian EFL Journal Quarterly, 8 /2, 1 80 - 20 1 Retrieved September 12 , 20 08 from the World Wide Web: http://www.asian-efljournal.com/June _06 _ns.php ... Journal, 24 /1, 1 - 20 Retrieved November 24 , 20 08 from the World Wide Web: http://www.asian-efl-journal.com/pta_nov _07 _dd.pdf 13 Fan, Y M ( 20 03 ) Frequency of use, perceived usefulness, and actual ... (19 90) Some notes on Eurocentres Vocabulary Tests Retrieved January 12 , 20 09 from http://www.lognostics.co.uk/vlibrary/meara1990b.pdf 23 Miller, J.L ( 20 05 ) Adult L2 Learners Recollections of Their...
- 5
- 472
- 1
The use of the Internet tool as an assistance for first-year non-major students at Namdinh University of Technology Education in basic English self-study
... 10 . 75 11 .3 Standard Error 0. 4859878 71 0. 4 925 7647 Standard Deviation 2. 17 3 403 8 31 2. 2 02 8 68943 Sample Variance 4. 723 68 4 21 1 4.8 526 315 79 Range 7 Sum 21 5 22 6 Count 20 20 Confidence Level(95 .0% ) 1 . 01 718 4 3 01 ... scores of Experimental group Experimental Group Pretest Posttest Mean 11 .15 14 .5 Standard Error 0. 514 3979 62 0. 494 708 846 Standard Deviation 2. 300 457 62 2 . 21 2 40 5 21 7 Sample Variance 5 .29 2 10 526 3 4.8947368 42 ... 5 .29 2 10 526 3 4. 723 68 4 21 1 Observations 20 20 Pooled Variance 5 .00 7894737 Hypothesized Mean Difference df 38 t Stat 0. 56 523 9359 P(T
- 15
- 557
- 0
Common errors in the use of the English passive made by the grade 10 Non-English Majors at Tran Phu Specialised High School, Hai Phong
... grammar of present day English Mosco Vyssgja Skola, 19 82 10 Illinois, R Composition and Grammar Laidlaw brothers Published, 19 85 11 Lennon, P, 19 91 Error: some problems of definition and identification, ... University Press, 20 05 14 Quirk, R and S Greenbaum and G.Leech and J Svartrick A grammar of contemporary English Longman group Limited, London, 19 72 15 Richards, J.C et al .19 92 Dictionary of language ... for these errors? + What are possible solutions to help the students overcome these errors? III Scope of the study: The study is focused on the passive voice However, it is not my ambition to cover...
- 3
- 416
- 0
Use of DDGS in Swine Diets
... Pigs Fed Diets Containing 0, 10 , 20 , and 30% DDGS 0% 10 % 20 % 30% c 54.3 55 .1 55.8 55.5 L* 3 .2 3 .2 3 .1 3 .1 Color scored e 2. 2 2. 0 2. 1 2. 1 Firmness score f 1. 9 1. 9 1. 7 1. 9 Marbling score 5.6 5.6 ... Containing 0, 10 , 20 and 30% DDGS 0% 10 % 20 % 30% DDGS DDGS DDGS DDGS 3 .15 a 3 .00 ab 2. 84bc 2. 71c Belly thickness, cm 24 .4a 25 .1a 21 .3b 27 .3a Belly firmness score, degrees d de d 25 .9 23 .8 25 .4 22 .4e ... 5.6 5.6 5.6 5.6 Ultimate pH a b 2. 4 2. 8 2. 5 2. 1 11- d purge loss, % 0. 7 0. 7 0. 7 0. 7 24 -hr drip loss, % 18 .7 18 .5 18 .3 18 .8 Cooking loss, % 21 .4 21 .5 21 .8 22 .1 Total moisture loss, %g h 3.4 3.4...
- 15
- 843
- 1
Báo cáo y học: "Use of chinese and western over-the-counter medications in Hong Kong"
... 1. 37) NS 1. 57 (1. 19, 2. 08 ) 0. 0 02 50- 59 1. 18 (0. 92, 1. 49) NS 1. 49 (1. 11, 2. 01 ) 0. 009 60- 69 1. 40 (1 .06 , 1. 86) 0. 02 0 2. 08 (1. 48, 2. 92) < 0. 0 01 1. 75 (1. 30, 2. 35) < 0. 0 01 1. 98 (1. 38, 2. 84) < 0. 0 01 ... (1 .07 , 1. 53) 0. 007 1 .05 (0. 94, 1. 18) NS 50- 59 1. 14 (0. 93, 1. 39) NS 0. 90 (0. 79, 1. 02 ) NS 60- 69 0. 93 (0. 73, 1. 19) NS 0. 73 (0. 63, 0. 85) < 0. 0 01 0. 50 (0. 38, 0. 67) < 0. 0 01 0. 49 (0. 42, 0. 57) < 0. 0 01 ... ( $15 1. 10 ) $9 305 ($ 306 . 72) p< 0. 0 01 p< 0. 0 01 p< 0. 0 01 21 .7 Total Mean personal monthly income in $ 1 20 60 ($3 50. 59) Hong Kong dollarsb (Standard Error) p< 0. 0 01 21 .4 22 .2 p< 0. 0 01 p< 0. 0 01 a : All from...
- 9
- 516
- 0
Báo cáo y học: "Use of the measure your medical outcome profile (MYMOP2) and W-BQ12 (Well-Being) outcomes measures to evaluate chiropractic treatment: an observational study"
... 3 20 01 8 05 8* 675 Activity (A) rs p (2- tailed) - .22 9* 10 3 - .03 7* 7 92 - .26 8* 05 8 05 8* 6 82 Wellbeing (WB) rs p (2- tailed) - 5 12 < 00 1 -. 311 02 2 -.445 00 1 358 00 8 Profile (P) rs p (2- tailed) -.3 72 ... MYMOP2 scores (SD)a Symptom S1 (SD) 3.9 (1. 1) 3.9 (1. 1) 1. 5 (1 .2) Symptom S2 (SD) 3.6 (1 .2) 3.5 (1 .2) 1. 5 (1. 1) Activity A (SD) 3.9 (1. 4) 3.9 (1. 5) 1. 4 (1. 1) Well-being W (SD) 2. 5 (1. 3) 2. 6 (1. 3) ... 2. 6 (1. 3) 1. 6 (1. 3) Profile P (SD) 3.4 (1 .0) 3.5 (0. 9) 1. 6 (1 .0) 1. 4 (1. 5) 7 .1 (2. 5) 1. 4 (1. 3) 6.9 (2. 5) 1 .0 (1. 3) 7.7 (2. 5) Positive well-being PWB 8.6 (2. 5) 8.5 (4.4) 10 . 0 (4.4) General well-being...
- 8
- 538
- 0
Tìm thêm: xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25