0

operations management as a business function

Knowledge Management as a Catalyst for Innovation within Organizations: A Qualitative Study

Knowledge Management as a Catalyst for Innovation within Organizations: A Qualitative Study

Tin học văn phòng

... dissemination, KU=knowledge use)RESEARCH ARTICLE Knowledge and Process Management 240 R. McAdam &Research ArticleKnowledge Management as a Catalystfor Innovation within Organizations: A Qualitative ... ownideas in small teams).RESEARCH ARTICLE Knowledge and Process Management 236 R. McAdam `Knowledge management really is a necessarycondition before you can innovate.'The participants ... willdisseminate and embody new knowledge farbeyond the organizational boundaries, leading toincreased innovative partnerships and alliances(Nonaka and Takeuchi, 1995).If organizations are to systematically...
  • 9
  • 498
  • 2
Báo cáo khoa học: Identification of the N-terminal region of TjZNT2, a Zrt⁄Irt-like protein family metal transporter, as a novel functional region involved in metal ion selectivity ppt

Báo cáo khoa học: Identification of the N-terminal region of TjZNT2, a Zrt⁄Irt-like protein family metal transporter, as a novel functional region involved in metal ion selectivity ppt

Báo cáo khoa học

... 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIFTjZNT1 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFATjZNT2 74:LAGAAGVAIPLIGRNRRFLQTDGSLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPEFPWKKFPFPGFFATjZNT1 ... Harada E, Vess C, Roepenack-Lahaye E &Clemens S (2004) Comparative microarray analysis ofArabidopsis thaliana and Arabidopsis halleri roots identi-fies nicotianamine synthase, a ZIP transporter ... 322330.2 Kraămer U, Talke I & Hanikenne M (2007) Transitionmetal transport. FEBS Lett 581, 2263–2272.3 Tomatsu H, Takano J, Takahashi H, Watanabe-Takah-ashi A, Shibagaki N & Fujiwara T...
  • 8
  • 343
  • 0
Báo cáo khoa học: Homologous expression of a bacterial phytochrome The cyanobacterium Fremyella diplosiphon incorporates biliverdin as a genuine, functional chromophore doc

Báo cáo khoa học: Homologous expression of a bacterial phytochrome The cyanobacterium Fremyella diplosiphon incorporates biliverdin as a genuine, functional chromophore doc

Báo cáo khoa học

... (5Â-TATACCATGGGCTTAAGTCCTGAAAATTCTCCAG-3Â) and oBQ147(5Â-AAACTCGAGCCGGCCCTCAATTTTGACCTCCTGCAATGTGAAATAGAACG-3Â), and cloned between theNcoI and XhoI sites into pET2 8a( +), providing a His-tag inthe C-terminus ... 5Â-CATATGACGAATTGCCATCGCGAACC-3Â; and oBQ36, 5Â-GGATCCTTATTTGACCTCCTGCAATGTGAAATAG-3Â (restriction sitesare underlined, and start and stop codons are given in bold).The PCR product was then ... cyano-bacteria [9], e.g. Calothrix PCC7601 [10] and AnabaenaPCC7120, and also in proteobacteria s uch a s Deinococcusradiodurans, Pseudomonas aeruginosa [3,11] and Agro-bacterium tumefaciens...
  • 11
  • 440
  • 0
Tài liệu The Man of Letters as a Man of Business docx

Tài liệu The Man of Letters as a Man of Business docx

Quản trị kinh doanh

... readers than I should in writing of him as an Artist. Besides, as an artist hehas been done a great deal already; and a commercial state like ours has really more concern in him as a business man. ... page. He knows that there is always a dangerthat the reigning favorite may fail to please; that at any rate, in the order of things, he is passing away, and thatif the magazine is not to pass ... hispresent low grade among business men. As I have hinted, it is but a little while that he has had any standing at all. I may say that it is only since thewas that literature has become a business with...
  • 21
  • 544
  • 0
Tài liệu Teaching IT Project Management to Postgraduate Business Students: A Practical Approach ppt

Tài liệu Teaching IT Project Management to Postgraduate Business Students: A Practical Approach ppt

Quản lý dự án

... programming, data entry and the implementation of database projects. This group is managed by its Team Leader and its operations are overseen by the Project Manager. Case Study: Paramount Business ... experience has shown that somewhere around 30-40 tasks are about right, but that it is very important to insist on the use of summary tasks as well as detail tasks. Case studies have included: an office ... documentation for a TPS, SuperFast Consultancy Services – fast dial-up directory services and a PC-LAN installation at the Department of Administrative Affairs. After this part of the assignment has been...
  • 14
  • 536
  • 0
Tài liệu Using Proven Sales Techniques for Selling WorkKeys as a Solution to Business doc

Tài liệu Using Proven Sales Techniques for Selling WorkKeys as a Solution to Business doc

Tiếp thị - Bán hàng

... Place your nametag on your right; it's easier to read when shaking hands (since most are right-handed). 4.  Actively greet others. 5.  Give a strong handshake. 6.  Prepare an “elevator ... belle loves and loses and loves again a slyly dashing war profiteer as she struggles to protect her family and beloved plantation. ã A pig raised by sheepdogs, learns to herd sheep with a little ... Key Attributes of a Great Sale Make a list of the 3 attributes or personal characteristics of a successful salesperson based on your observations of top salespeople you’ve met… Attributes...
  • 48
  • 482
  • 0
Tài liệu Báo cáo khoa học: Peroxiredoxin II functions as a signal terminator for H2O2-activated phospholipase D1 doc

Tài liệu Báo cáo khoa học: Peroxiredoxin II functions as a signal terminator for H2O2-activated phospholipase D1 doc

Báo cáo khoa học

... withpre-equilibrated Ni ⁄ nitrilotriacetate ⁄ agarose (Qiagen, Valen-cia, CA, USA), and rocked at 4 °C for 1 h. The lysate ⁄ Ni ⁄nitrilotriacetate bead mixture was transferred to a poly prepchromatography ... physiological ratherthan an artifact of lysis. These results also support,using a visual rather than molecular biochemicalapproach, the proposal that PMA triggers increasedinteraction between PLD1 and ... functions as a signal terminatorfor H2O2-activated phospholipase D1Nianzhou Xiao, Guangwei Du and Michael A. FrohmanDepartment of Pharmacology and the Center for Developmental Genetics,...
  • 9
  • 401
  • 0
Báo cáo khoa học: Nup358, a nucleoporin, functions as a key determinant of the nuclear pore complex structure remodeling during skeletal myogenesis docx

Báo cáo khoa học: Nup358, a nucleoporin, functions as a key determinant of the nuclear pore complex structure remodeling during skeletal myogenesis docx

Báo cáo khoa học

... RevNES (5Â-GATCTCCTCTTCAGCTACCACCGCTTGAGAGACTTACTCTTGATTGTAACGAGGATA-3Â and 5Â-AGCTTATCCTCGTTACAATCAAGAGTAAGTCTCTCAAGCGGTGGTAGCTGAAGAGG A- 3Â) were annealed and inserted into the BglII and HindIIIsites ... and 5Â-AUAAGUAAUUUCUACGACGdTdT-3Â; Nup358, 5Â-CCAGUCACUUACAAUUAAAdTdT-3Â and 5Â-UUUAAUUGUAAGUGACUGGdTdT-3Â(siNup358-1), 5Â-UGAAGCACAUGCUAUAAAAdTdT-3Âand 5Â-UUUUAUAGCAUGUGCUUCAdTdT-3Â (siNup-358-2)]. ... Differential localization ofHDAC4 orchestrates muscle differentiation. NucleicAcids Res 29, 3439–3447.22 Yasuhara N, Shibazaki N, Tanaka S, Nagai M, Kamik-awa Y, Oe S, Asally M, Kamachi Y,...
  • 12
  • 454
  • 0
Báo cáo khoa học: The oxidative effect of bacterial lipopolysaccharide on native and cross-linked human hemoglobin as a function of the structure of the lipopolysaccharide A comparison of the effects of smooth and rough lipopolysaccharide ppt

Báo cáo khoa học: The oxidative effect of bacterial lipopolysaccharide on native and cross-linked human hemoglobin as a function of the structure of the lipopolysaccharide A comparison of the effects of smooth and rough lipopolysaccharide ppt

Báo cáo khoa học

... a water molecule which can then accelerate thedisplacement of the protonated superoxide anion, as wassuggested by Tsuruga and Shikama [21] to explain theincrease in oxidation rate of the a ... (data not shown). As was observed previouslyby others [5], the reaction is biphasic at pH 7.4 and below,with an initial fast phase followed by a slower phase. Todetermine the optimum pH at ... metHb. Theamount of hemichrome produced during a 2-h reaction wastypically less than 10% (data not shown). The decrease inconcentration of oxyHb with time was utilized as a measureof the rate of...
  • 6
  • 748
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "GAMR VIEWED AS A FUNCTIONING PART OF A COGNITIVES SERM A YTM" pot

Báo cáo khoa học

... grammar can be affected in isolation from other aspects of language function. (Cf Studies of agrammatic and Broca's aphasia as described in Goodenough, Zurif, and Weintraub, 1977; Goodglass, ... any information associated with a name, for instance, an activity value, is viewable from any spaces in which the name exists. This means that any interpreted meaning associated with a name ... to the grammatical representation is that the syntactic category aspect of each meaning of a phonetic word is also a part of the grammatical representation where it makes associations with...
  • 9
  • 379
  • 0
Characterization of Spin Coated Polymers in Nano-environments as a Function of Film Thickness pot

Characterization of Spin Coated Polymers in Nano-environments as a Function of Film Thickness pot

Điện - Điện tử

... shaft, can gauge 223.1.3.5 Thermal Mechanical Analysis A TA Instruments DMA 2980 was used in penetration mode to measure the Tg ofthe PMMA films cast on silicon. Each sample was placed into a ... maintaining constant amplitude of oscillation as the surface height changes. A laser beam records the deflection of the cantilever beam as the tip rasters along the surface. Typically a height image, ... compared. The 100c samplehad a contact angle of 91.2°. The surface washed in chloroform was more polarcompared that washed in toluene as illustrated by the 12.6° decrease in the contact angleof...
  • 80
  • 375
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "A PROLOG IMPLEMENTATION OF LEXICAL LANGUAGE FUNCTIONAL PROCESSING GRAMMAR SYSTEM AS A BASE FOR A NATURAL" pdf

Báo cáo khoa học

... IMPLEMENTATION OF LEXICAL FUNCTIONAL GRAMMAR AS A BASE FOR A NATURAL LANGUAGE PROCESSING SYSTEM Werner Frey and Uwe Reyle Department of Llngulstlcs University of Stuttgart W-Germany O. ABSIRACr ... logical relations? Recall that each clause has a unique head end that the functional features of each phrase are identified with those of its head. For (3) the head of S -~> NPVP is the VP and ... semantic representation of the already analyzed discourse S(1), ,S(i-l) as well as on a database containing the knowledge the text talks about. ~ requirement is of major importance for the analysis...
  • 6
  • 476
  • 0
Báo cáo khoa học: A novel plant protein disulfide isomerase family homologous to animal P5 – molecular cloning and characterization as a functional protein for folding of soybean seed-storage proteins docx

Báo cáo khoa học: A novel plant protein disulfide isomerase family homologous to animal P5 – molecular cloning and characterization as a functional protein for folding of soybean seed-storage proteins docx

Báo cáo khoa học

... peptide was constructed as follows. TheDNA fragment was amplified from GmPDIM cDNA byPCR using the primers 5Â-GACGACGACAAGATGCACGCACTCTATGGAGC-3Â and 5Â-GAGGAGAAGCCCGGTTCATAGCTCATCCTTGCTTGAAG-3Â. ... RNase A PDI activity was assayed by measuring RNase activity pro-duced through the regeneration of the active form fromreduced and denatured RNase A. Reduced and denaturedRNase A was prepared ... soybean cotyledons during matu-ration. (A) GmPDIM mRNA was quantified by real time RT-PCR.Each value was standardized by dividing the value by that for actinmRNA. Values are calculated as a percentage...
  • 12
  • 348
  • 0
Báo cáo khoa học: RNA helicase A interacts with nuclear factor jB p65 and functions as a transcriptional coactivator pot

Báo cáo khoa học: RNA helicase A interacts with nuclear factor jB p65 and functions as a transcriptional coactivator pot

Báo cáo khoa học

... helicase A interacts with nuclear factor jB p65 and functions as a transcriptional coactivatorToshifumi Tetsuka1, Hiroaki Uranishi1, Takaomi Sanda1, Kaori Asamitsu1, Jiang-Ping Yang2,Flossie ... of California San Diego, La Jolla, CA, USARNA helicase A (RHA), a member of DNA and RNAhelicase f amily containing ATPase activity, is involved inmany steps of gene expression such as transcription ... (siRNA) 5Â-GCAUAAAACUUCUGCGUCU-3Â was targeted to the RHA portion from 2408 to2426. Control siRNA 5Â-AUUCUAUCACUAGCGUGAC-3Â was purchased from Dharmacon (Lafayette, CO,USA). siRNA transfections...
  • 11
  • 485
  • 0
Báo cáo khoa học: Mammalian transglutaminases Identification of substrates as a key to physiological function and physiopathological relevance pot

Báo cáo khoa học: Mammalian transglutaminases Identification of substrates as a key to physiological function and physiopathological relevance pot

Báo cáo khoa học

... TG, transglutaminase.FEBS Journal 272 (2005) 615–631 ª 2004 FEBS 615 132 Akagi A, Tajima S, Ishibashi A, Matsubara Y, Takeh-ana M, Kobayashi S & Yamaguchi, N. (2002) Type XVIcollagen is ... will cast light onthe functions of transglutaminases and their involvement in human dis-eases. In this paper we review data on the properties of mammalian trans-glutaminases, particularly as ... relevanceCarla Esposito and Ivana CaputoDepartment of Chemistry, University of Salerno, ItalyMammalian transglutaminases andtheir catalytic activityTransglutaminases (TGs; EC 2.3.2.13) are encoded...
  • 17
  • 440
  • 0

Xem thêm