the internal energy as a state function
Báo cáo khoa học: Identification of the N-terminal region of TjZNT2, a Zrt⁄Irt-like protein family metal transporter, as a novel functional region involved in metal ion selectivity ppt
Ngày tải lên :
29/03/2014, 00:20
... -MASSPTKILCDAGESDLCRDDAAAFLLKFVAIASIL 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF TjZNT1 TjZNT2 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFA ... in YNB medium at 30 °C, and imaged with a laser scanning confocal microscope (FV 1000; Olympus, Tokyo, Japan) Metal accumulation assay The Cd2+ accumulation assay was performed as described in ... were harvested, washed twice, and resuspended in an ice-cold assay buffer (LZM-EDTA) Then, the attenuance of the cell suspensions was measured Cells were incubated in the assay buffer containing...
- 8
- 343
- 0
Báo cáo khoa học: Homologous expression of a bacterial phytochrome The cyanobacterium Fremyella diplosiphon incorporates biliverdin as a genuine, functional chromophore doc
Ngày tải lên :
30/03/2014, 08:20
... TTGGTTCGCGATCTGAATTCGTCAAGTCCACCTC-3¢ The primers used for H26 7A were: oBQ144-2, 5¢-CACT CGGTACTCCGCAGCGTTTCGCCGTTARCCATTGAA TATTTGCACAATATGG-3¢ (R ¼ purine); and oBQ145-2, 5¢-CCATATTGTGCAAATATTCAATGGYTAACGGCG ... was termed pPL9b CphBm was amplified from genomic DNA from PCC7601 using primers oBQ146 (5¢-TATACCATGG GCTTAAGTCCTGAAAATTCTCCAG-3¢) and oBQ147 (5¢-AAACTCGAGCCGGCCCTCAATTTTGACCTCCTGC AATGTGAAATAGAACG-3¢), ... other cyanobacteria [9], e.g Calothrix PCC7601 [10] and Anabaena PCC7120, and also in proteobacteria such as Deinococcus radiodurans, Pseudomonas aeruginosa [3,11] and Agrobacterium tumefaciens...
- 11
- 440
- 0
Tài liệu The Value of the Case Study as a Research Strategy doc
Ngày tải lên :
20/02/2014, 11:20
... research programme: It is for this reason that researchers like Yin are especially adamant that a case database be created and maintained to \allow repetition and re-evaluation of cases Reliability ... important during the data collection phase, and involves the use of case study protocol as well as the case study database already mentioned Validity and reliability can thus be built into a case ... that the application of the methodology is as likely (perhaps inherently) at fault as the methodology itself Qualitative research as preparation - As mentioned above, qualitative research has a...
- 15
- 587
- 0
Báo cáo khoa học: Distribution of the extrinsic proteins as a potential marker for the evolution of photosynthetic oxygen-evolving photosystem II ppt
Ngày tải lên :
23/03/2014, 15:21
... Rhodophyceae (red algae) Cyanidioschyzon merolae Nuclear DNA Chloroplast DNA Cyanidium caldarium Chloroplast DNA Bacillariophyceae (diatoms) Thalassiosira pseudonana Nuclear DNA Chloroplast DNA Odontella ... red algal protein than with the cyanobacterial one The C paradoxa thylakoid membranes also contained a band cross-reacted with anti-(R-PsbQ¢), the apparent molecular mass of which was remarkably ... Odontella sinensis Chloroplast DNA Prasinophyceae Mesostigma viride Chloroplast DNA Euglenophyceae Euglena gracilis Chloroplast DNA Chlorophyceae (green algae) Chlamydomonas reinhardtii Nuclear DNA...
- 11
- 501
- 0
báo cáo hóa học: "Transmembrane potential induced on the internal organelle by a time-varying magnetic field: a model study" pdf
Ngày tải lên :
19/06/2014, 08:20
... phase of mitochondria polarization At extremely low values (
- 15
- 413
- 0
Báo cáo hóa học: " Biofabrication of Anisotropic Gold Nanotriangles Using Extract of Endophytic Aspergillus clavatus as a Dual Functional Reductant and Stabilizer" potx
Ngày tải lên :
21/06/2014, 08:20
... P, Ahmad A, Mandal D, Senapati S, Sainkar SR, Khan MI, Ramani R, Parischa R, Kumar PAV, Alam M, Sastry M, Kumar R: Angew Chem Int Ed 2001, 40:3585 14 Ahmad A, Senapati S, Khan MI, Kumar R, Ramani ... biomass-based reduction Characterization of Gold Nanotriangles Experimental Details Isolation of Endophytic Aspergillus clavatus The host plant Azadirachta indica A Juss was surveyed, and samples ... Srinivas V, Sastry M: Nanotechnology 2003, 14:824 15 Gade AK, Bonde PP, Ingle AP, Marcato P, Duran N, Rai MK: J Biobased Mat Bioener 2008, 2:1 16 Vigneshwaran N, Ashtaputre NM, Varadarajan PV, Nachane...
- 7
- 261
- 0
The phrase Phrase as a group of words, which makes sence, but not complete sense,
Ngày tải lên :
13/07/2014, 23:26
... modifies Ex: The senile old man disease Many case of infectious A story as old as time The Phrase A noun phrase: A noun phrase consits of a noun and all it modifies Ex: The senile old man Many case of ... that “ she” functions in exactly the same way as “ The beautiful girl” and “ arrived” in exactly the way as “ has arrived” Concentrating on the similarity of function, they define a noun phrase ... phrase Adjective pharse Verb phrase Adverb phrase Preposition pharse The Phrase There are five commonly occurring types of phrase in English: A noun phrase: A noun phrase consits of a noun and all...
- 9
- 512
- 0
Báo cáo toán học: "On the Generalized Convolution with a Weight - Function for Fourier, Fourier Cosine and Sine Transforms" pot
Ngày tải lên :
06/08/2014, 05:20
... Russian) V A Kakichev and Nguyen Xuan Thao, On the design method for the generalized integral convolution, Izv Vuzov Mat (1998) 31–40 (in Russian) V A Kakichev and Nguyen Xuan Thao, On the generalized ... with a weightfunction for the Cosine - Fourier integral transform, Acta Math Vietnam 29 (2004) 149–162 15 Nguyen Xuan Thao and Nguyen Thanh Hai, Convolution for Integral Transforms and Their Application, ... Their Application, Russian Academy, Moscow, 1997 16 Nguyen Xuan Thao and Trinh Tuan, On the generalized convolution for I transform, Acta Math Vietnam 28 (2003) 159–174 17 M Saigo and S B Yakubovich,...
- 16
- 336
- 0
Báo cáo sinh học: "The THO complex as a key mRNP biogenesis factor in development and cell differentiation" potx
Ngày tải lên :
06/08/2014, 19:21
... identified as a transcriptional activator that interacts with the SAGA transcription factor, opens up the possibility of a co-transcriptional action of THO in higher eukaryotes [9] The impact of ... of activity Acknowledgements We thank R Luna and AG Rondón for critical reading of the manuscript The work of AA’s laboratory is funded by the Spanish Ministry of Innovation and Junta de Andaluc a ... development and differentiation The relevance of THO in cell physiology has been clearly shown from yeast to humans Yeast THO null mutants are sick and slow growers and THO depletion has a negative...
- 3
- 247
- 0
Báo cáo lâm nghiệp: "Frost damage on the terminal shoot as a risk factor of fork incidence on common beech (Fagus sylvatica L.)" docx
Ngày tải lên :
07/08/2014, 16:20
... explanatory factor which was much significant than the other variables and factors available Thus overall, the damage factor had both a statistical and a causal value, i.e functional and more precisely ... experimental method has the advantage of allowing one to bypass the frost itself in a way, as its characteristics are always difficult to define accurately at the tree scale This type of experiment also ... damage to the spring shoot Thus according to general epidemiological laws, the causal nature of a relationship was particularly well demonstrated when the emergence of a phenomenon was increased...
- 8
- 348
- 0
Báo cáo y học: "Direct Toll-like receptor 2 mediated co-stimulation of T cells in the mouse system as a basis for chronic inflammatory joint disease" ppsx
Ngày tải lên :
09/08/2014, 01:23
... obtained was used as a template for real-time quantitative polymerase chain reaction, which was performed with the LC FastStart DNA Master SYBR GreenI® (Roche Diagnostics, Mannheim, Germany) in a LightCycler® ... 2:116-126 20 Matsuyama T, Yamada A, Kay J, Yamada KM, Akiyama SK, Schlossman SF, Morimoto C: Activation of CD4 cells by fibronectin and anti-CD3 antibody A synergistic effect mediated by the VLA-5 fibronectin ... receptors and are activated by lipopolysaccharide J Exp Med 2003, 197:403-411 Nagai Y, Akashi S, Nagafuku M, Ogata M, Iwakura Y, Akira S, Kitamura T, Kosugi A, Kimoto M, Miyake K: Essential role...
- 14
- 505
- 0
báo cáo khoa học: "Malignant fibrous histiocytoma of the urinary bladder as a post-radiation secondary cancer: a case report" pdf
Ngày tải lên :
10/08/2014, 22:20
... Gross pathological examination revealed a large mass on the left lateral wall that measured 7.0 cm across its greatest dimension The surface of the tumor on the mucosal side was smooth The mass ... tomography of the pelvic cavity at the levels of the neoplasm was detected at the L5 spine level, and palliative radiation therapy in that area was suggested Despite aggressive surgical treatment along ... found sarcomatoid components in high-grade urothelial carcinomas, and limited clinical information available From gross pathological examination, the mass was obviously unlikely for carcinomas, as...
- 6
- 493
- 0
Báo cáo y học: "Metastatic breast carcinoma in the mandible presenting as a periodontal abscess: a case report" pps
Ngày tải lên :
10/08/2014, 23:21
... involve a significant medical history The management of metastatic breast carcinomas of the oral cavity is primarily palliative and may include radiotherapy, chemotherapy, hormone therapy and, rarely, ... the buccal gingiva of the mandibular molar region and drainage of purulent exudate Page of in the mesial buccal aspect of the third molar An examination of the intra-oral area innervated by the ... diagnostic of metastases On the basis of the patient’s medical history and paresthesia of the lower lip and chin, metastatic disease was highly suspected The differential diagnosis included acute...
- 5
- 328
- 0
báo cáo khoa học: "Successful interdisciplinary management of the misdeployment of two self-expanding stents into the internal carotid artery: a case report" pps
Ngày tải lên :
11/08/2014, 02:22
... a joint statement from the American Academy of Neurology, the American Association of Neurological Surgeons, the American Society of Interventional and Therapeutic Neuroradiology, the American ... temporary clamping of the right ICA by improving the collateral supply using endovascular means With regard to the anesthesiological and surgical methods, local anesthesia during CEA with the eversion ... improve the potential collateral supply during subsequent stentectomy and CEA Dual platelet antiaggregation with acetylsalicylic acid and clopidogrel was initiated Under general anesthesia the stenoses...
- 4
- 346
- 0
Báo cáo y học: "EXACKTE2: Exploiting the clinical consultation as a knowledge transfer and exchange environment: a study protocol" pptx
Ngày tải lên :
11/08/2014, 05:21
... Care JG is a Tier Canada Research Chair in Health Knowledge Transfer and Uptake and leads Knowledge Translation Canada (KT Canada), a national research network in Canada FL, ML and MO are members ... to as a measure of self-efficacy As stated by Makoul and Clayman, 'the rationale for incorporating a patient's efficacy expectation parallels the argument for discussing patient preferences and ... CFA [48] In other words, we will assess and compare the number of items that load on the latent dimension as well as their loading value We will assess possible item bias using the Mantel-Haenszel...
- 11
- 369
- 0
báo cáo khoa học: " Implementing and evaluating a regional strategy to improve testing rates in VA patients at risk for HIV, utilizing the QUERI process as a guiding framework: QUERI Series" pptx
Ngày tải lên :
11/08/2014, 05:22
... printed materials such as e-mail communications, pocket cards, posters and flyers, and removal of organizational barriers) are the same at all stations The audit feedback program is directed at all ... We also have encouraged nurse-based rather than physician-based pre-test counseling [40] Nurses perform many educational, health promotion, and disease prevention tasks as well as physicians ... assistants, and post-graduate medical trainees) from the primary care administration staff at Facilities A and B The data on provider types were used to compare HIV testing and evaluation performance across...
- 13
- 341
- 0
Báo cáo y học: "Dermoid cyst of the urinary bladder as a differential diagnosis of bladder calculus: a case report" pps
Ngày tải lên :
11/08/2014, 10:23
... Bladder teratoma: a case report and review of literature Indian J Cancer 1997, 34:20-21 Agrawal S, Khurana N, Mandhani A, Agrawal V, Jain M: Primary bladder dermoid: a case report and review of the ... diverticuli and vesical stones [5] This tumour was a solitary tumour at the apex of the bladder It contained calcified material and fat The anterior midline position of the bladder mass in this patient ... 85:796-799 Sabnis RB, Bradoo AM, Desai RM, Bhatt RM, Randive NU: Primary benign vesical teratoma A case report Arch Esp Urol 1993, 46:444-445 Misra S, Agarwal PK, Tandon RK, Wakhlu AK, Misra NC: Bladder...
- 3
- 231
- 0
Báo cáo y học: " Involvement of the genicular branches in cystic adventitial disease of the popliteal artery as a possible marker of unfavourable early clinical outcome: a case report" pps
Ngày tải lên :
11/08/2014, 12:20
... this article as: Ypsilantis and Tisi: Involvement of the genicular branches in cystic adventitial disease of the popliteal artery as a possible marker of unfavourable early clinical outcome: a case ... Goodreaau JJ, Bergan JJ: Summary of cases of adventitial cystic disease of the popliteal artery Ann Surg 1979, 189:165-175 Cassar K, Engeset J: Cystic adventitial disease: a trap for the unwary ... underwent a surgical exploration of his popliteal artery under general anaesthesia through a posterior approach that allowed adequate exposure of the popliteal artery and cysts Evacuation of all three...
- 4
- 333
- 0