lifeburst a novel
lifeburst a novel
- 285
- 299
- 0
Báo cáo y học: "Endoscopic Facet Debridement for the treatment of facet arthritic pain – a novel new technique
... Primary outcome measure was percent change in facet-related pain as measured by Visual Analog Scale (VAS) score at final follow-up visit. Secondary outcome was change in OSWESTRY disability index ... of fol-low-up was at least 3 years with a maximum of 6 years. Location of facet pain was cervical in 45, tho-racic in 15, and lumbar in 114 patients. Surgical times varied based on the number ... dorsal nerve medial branch, Staender et al. 17 reported a mean VAS pain score re-duction of 3.3 at six months follow-up; 40% of patients had relief for at least 12 months, and mean duration...
- 4
- 599
- 0
Báo cáo y học: " A Novel Variable Number of Tandem Repeat of the Natriuretic Peptide Precursor B gene’s 5’-Flanking Region is Associated with Essential Hypertension among Japanese Females"
... Tamura N, Ogawa Y, Chusho H, et al. Cardiac fibrosis in mice lacking brain natriuretic peptide. Proc Natl Acad Sci USA. 2000; 97: 4239-44. 7. Mukoyama M, Nakao K, Saito Y, et al. Human brain ... 5’-AAGGAGGCACTGGGAGAGGGGAAAT-3’ (bases -1323 to -1299) and antisense, 5’- CCCCACCAAGCCAACACAGGATGGA -3’ (bases -919 to-895) were used to amplify a 429-bp product from genomic DNA (Fig. 1A) . The PCR ... thermal asymmet-ric interlaced polymerase chain reaction. Med Sci Monit. 2001; 7: 345-9. 14. Ogawa Y, Itoh H, Nakagawa O, et al. Characterization of the 5'-flanking region and chromosomal...
- 7
- 612
- 1
Báo cáo y học: " Vgf is a novel biomarker associated with muscle weakness in amyotrophic lateral sclerosis (ALS), with a potential role in disease pathogenesis"
... Zhao Z, Lange DJ, Voustianiouk A, Macgrogan D, Ho L, Suh J, Humala N, Thiyagarajan M, Wang J, Pasinetti GM. A ketogenic diet as a potential novel therapeutic intervention in amyotrophic lateral ... incubation with a reporter antibody (HRP–conjugated anti–rabbit IgG, Santa Cruz Biotech, CA). The assay was developed using a stabilized HRP substrate. All samples were analyzed in the linear ... by ALS grant from the Department of Veterans Affairs, NCCAM 5R21 AT002602-02 and NCCAM 1R21 AT003632-0 1A1 to GMP and NARSAD and DK071308 to SRS. Conflict of interest The authors have declared...
- 8
- 499
- 0
Research on a novel buck boost converter for wind turbine systems
... (4) In practical implementation of an inverter control, a sinusoidal reference wave, serving as the modulating signal, is compared with a triangular wave, serving as the carrier signal. The ... proposed flyback single-stage single-phase buck-boost inverter can accomplish both buck and boost operation, feeding power to a grid with a reasonable power quality from a widely variable dc source. ... the voltage boost [1]. Although they can accommodate a wide range of input voltage, the complicated structure makes them costly, particularly for small wind turbine systems. A single-stage inverter...
- 6
- 416
- 0
A novel interval method for validating state enclosures of the
... enclosures are2the words validated, guaranteed, and verified are used interchangeably to denote that state enclosures aremathematically and not only empirically proven to be correct.Traditional validated ... II-C. Although they are fairly efficient for exactly known initial states and parameters, theyare sometimes insufficient for practical scenarios with uncertain but bounded initial states and parameterswhich ... is1Further information about ValEncIA-IVP as well as free software are available at http://www.valencia-ivp.com.6of the error boundsR(κ+1)(t). Note that neither separate calculation of bounds...
- 12
- 373
- 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... purchased from Toyobo (Osaka, Japan). Emul-gen 911 was a gift from Kao Chemical (Tokyo, Japan).NADPH, NADH and NADP+were purchased fromOriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamicacid ... from Azotobacter vinelandii, ZP_00417949; FNR from Rhodobact-er capsulatus, AAF35905; ADR from Homo sapiens, AAB59498; adrenodoxin reductase from Saccharomyces cerevisiae, AAB64812; FprAfrom...
- 14
- 617
- 0
Tài liệu Báo cáo khoa học: Isolation and molecular characterization of a novel D-hydantoinase from Jannaschia sp. CCS1 docx
... molecular basis of enzyme thermosta-bility. J Bacteriol 185, 4038–4049.20 Nanba H, Yajima K, Takano M, Yamada Y, IkenakaY & Takahashi S (1997) Process for producing d-N-car-bamoyl -a- amino acid. ... Bommarius AS, Schwarm M & Drauz K (1998) Biocatal-ysis to amino acid-based chiral pharmaceuticals - exam-ples and perspectives. J Mol Catal B-Enzym 5, 1–11.14 Liljeblad A & Kanerva LT ... DNAsequences flanking the Jannaschia sp. CCS1 HYDJsrevealed an ORF encoding a putative allantoate amido-hydrolase, which is part of the urate catabolic pathwayin many organisms [8]. In fact,...
- 14
- 621
- 0
Tài liệu Báo cáo khoa học: TransLISA, a novel quantitative, nonradioactive assay for transcription factor DNA-binding analyses pdf
... antisense AGCTGATCTTCGAAGATCTTCGAAGATMutated HSEsenseBiotin-TCGACTTCAAGCTTGTACAAGCTTGTAGMutated HSEantisenseAGCTGAAGTTCGAACATGTTCGAACATC‘Scrambled’oligonucleotideBiotin-AACGACGGTCGCTCCGCCTGGCT140406080100120Counts ... compilation ª 2009 FEBSTransLISA, a novel quantitative, nonradioactive assayfor transcription factor DNA-binding analysesKristiina A. Vuori1, Johanna K. Ahlskog2, Lea Sistonen2and Mikko ... procedureThe assay was run as a three-step assay: initial incubation ofthe sample and probe, addition and incubation of the sampleand acceptor beads in the plate wells, and addition of donorbeads with...
- 9
- 457
- 0
Tài liệu Báo cáo khoa học: Verprolin function in endocytosis and actin organization Roles of the Las17p (yeast WASP)-binding domain and a novel C-terminal actin-binding domain doc
... organizationRoles of the Las17p (yeast WASP)-binding domain and a novel C-terminal actin-binding domainThirumaran Thanabalu1,2, Rajamuthiah Rajmohan2, Lei Meng2, Gang Ren4,5, Parimala R. ... polyclonal GFP-spe-cific antiserum was a gift from J. Kahana and P. Silver(Dana Farber Cancer Center, Boston, MA). The anti-actinmAb was MAB1501 from Chemicon International (Teme-cula, CA). The anti-hexokinase ... vrp1D::KanMx bar1)[23], IDY166 (MATa his3 leu2 ura3 trp1 las17D::URA3 )[20], and PJ69- 4A (MATa his3 leu2 ura3 trp1 gal4D gal80Dmet2::GAL7-lacZ GAL2-ADE2 LYS2::GAL1–HIS3) [64].Yeast strain PJ69-4A...
- 23
- 679
- 0
Tài liệu Báo cáo khoa học: Identification of a novel matrix protein contained in a protein aggregate associated with collagen in fish otoliths pdf
... 5¢-CGCCTCGAGCTATTTGGGCTCTTTCATCAT-3¢; rOMM-64-IV, 5¢-CGCGGATCCGCCCCTGTTAATGATGGAACC-3¢ and 5¢-CGCCTCGAGCTAAGAAGACTGGGCTGCCAG-3¢; rOMM-64-V, 5¢-CGCGGATCCAGGCAAGATTTTAAGCATCCA-3¢ and 5 ¢-CGCCTCCACCTAAGAGGCATCCTTGTCCAC-3¢; ... 5¢-CGCCTCCACCTAAGAGGCATCCTTGTCCAC-3¢; rOMM-64-II, 5¢-CGCGGATCCACCGTAGACACTTATGATATA-3¢ and5¢-CGCCTCGAG CTAAGAGTCAG CTTGCACGTC-3 ¢;rOMM-64-III, 5¢-CGCGGATCCGCTGATGTGACCAGTGATGAC-3¢ and 5¢-CGCCTCGAGCTATTTGGGCTCTTTCATCAT-3¢; ... 3-1-1 Minato,Hakodate, Hokkaido 041-8611, JapanTel ⁄ Fax: +81 138 40 5550E-mail: takagi@fish.hokudai.ac.jpDatabaseNucleotide sequence data are available inthe DDBJ ⁄ EMBL ⁄ GenBank databases...
- 12
- 568
- 0
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx
... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells ... intensity was determined using imagemaster2d elite software 4.01 (Amersham Bioscience, Uppsala,Sweden).Statistical analysisData in bar graphs are expressed as the mean and standarddeviation of ... caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspaseassay was performed using the CaspACE colorimetric assaykit as described by the manufacturer (Promega)....
- 12
- 613
- 0
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt
... vulgaris).Biochem J 387, 85–91.25 Kanda A, Takahashi T, Satake H & Minakata H (2006)Molecular and functional characterization of a novel gonadotropin-releasing-hormone receptor isolated ... 8,459–467.10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K &Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland ofthe common octopus Octopus vulgaris. ... artificial seawater at 18 °C.Cloning of the partial-length cDNATotal RNA was extracted from Octopus tissues using Sepa-sol-RNA I Super (Nacalai tesque, Kyoto, Japan) accordingto the manufacturer’s...
- 11
- 595
- 0
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt
... NADPHwere also obtained from Sigma. Sephadex G-25 was pur-chased from Pharmacia (Uppsala, Sweden). All the othermaterials were of analytical grade and obtained fromBeijing Chemical Plant (Beijing, ... swelling and a decrease in mitochondria integrity.TBARS content in ferrous sulfate ⁄ ascorbate-treatedmitochondria was analyzed by thiobarbituric acid assay[34]. In this assay, thiobarbituric acid ... experi-ment carried out without the mimic, ascorbate, and ferroussulfate was known as the control group.Biological analysis of mimics againstmitochondrial damageMitochondrial swelling was assayed as...
- 9
- 491
- 0
Tài liệu Báo cáo khoa học: Characterization of the interaction between the plasma membrane H+-ATPase of Arabidopsis thaliana and a novel interactor (PPI1) doc
... MichelisMI (2002) A novel interaction partner for the C-termi-nus of Arabidopsis thaliana plasma membrane H+-ATP-ase (AHA1 isoform): site and mechanism of action onH+-ATPase activity differ ... gatggatcccatATGGGTGTTGAAGTTGTA annealing around the start codon of thePpi1 ORF and gactcgagATTAGTCGACTTCTTACGCannealing just before the putative transmembrane domain(capital letter in the sequence ... Villalba JM, Lanfermeijer FC & PalmgrenMG (1995) C-terminal deletion analysis of plant plasmamembrane H+-ATPase: yeast as model system for sol-ute transport across the plasma membrane....
- 8
- 629
- 0
Tài liệu Báo cáo khóa học: TbPDE1, a novel class I phosphodiesterase of Trypanosoma brucei pdf
... 5¢-GGGAATTCCATATGAGAGACAATATTTCCCGTTTATCAAATC-3¢ and 5¢-CCGCTCGAGTCATTACTAGGTTCCCTGTCCAGTGTTACC-3¢,andPDE1(Lys321–Thr620) was amplified with primers 5¢-GGGAATTCCATATGAAGAATGATCAATCTGGCTGCGGCGCAC-3¢ and 5¢-CCGCTCGAGTCATTACTAGGTTCCCTGTCCAGTGTTACC-3¢. ... parasites as potentialtargets for antiparasitic drugs. The African trypanosomeTrypanosoma brucei is the protozoon that causes the fatalhuman sleeping sickness, as well as Nagana, a devastatingdisease ... truncated fragments of TbPDE1were also amplified using the same protocol and pET-PDE1as template. PDE1(Arg189–Thr620) was amplified using theprimer pairs 5¢-GGGAATTCCATATGAGAGACAATATTTCCCGTTTATCAAATC-3¢...
- 11
- 566
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến dòng điện stato i1 fi p2 sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008