Adapting plan based re optimization of multiway join queries for streaming data
Adapting plan based re optimization of multiway join queries for streaming data
... satisfied in data- stream environments 2.2 Optimization for Streaming Data In this section, we will review approaches that are especially put forward for streaming settings, where queries are submitted ... intermediate results, and hence, they are the most challenging to re- optimize In this thesis, we concentrate on adapting plan- based re- optimization of multiway join queries over streaming data We ... which are actually representations of related schemas Then, queries are generated for each set and they are greedily chosen to run until all expressions are covered Lastly, chosen queries are executed...
- 116
- 239
- 0
Báo cáo hóa học: " Research Article Optimization of Linear Precoded OFDM for High-Data-Rate UWB Systems" pptx
... Mbit/s Figure 6: LP -OFDM performance with channel model CM1 CONCLUSION In this paper, we have proposed a linear precoded multicarrier waveform, called LP -OFDM, for high data rate UWB applications ... Furthermore, Theorem shows that the LP -OFDM noise margin can never be lower than the OFDM noise margin The LP -OFDM system range is therefore larger than the OFDM system range This result was expected ... considered Frames of 150 OFDM symbols are used, and a different channel realization is applied for each frame The performance is estimated for UWB channel models CM1 and CM2, in the case of perfect channel...
- 11
- 302
- 0
Báo cáo hóa học: " Research Article Optimization of Linear Precoded OFDM for High-Data-Rate UWB Systems" pdf
... Mbit/s Figure 6: LP -OFDM performance with channel model CM1 CONCLUSION In this paper, we have proposed a linear precoded multicarrier waveform, called LP -OFDM, for high data rate UWB applications ... Furthermore, Theorem shows that the LP -OFDM noise margin can never be lower than the OFDM noise margin The LP -OFDM system range is therefore larger than the OFDM system range This result was expected ... considered Frames of 150 OFDM symbols are used, and a different channel realization is applied for each frame The performance is estimated for UWB channel models CM1 and CM2, in the case of perfect channel...
- 11
- 271
- 0
Báo cáo khoa học: "A Re-examination of Machine Learning Approaches for Sentence-Level MT Evaluation" ppt
... on one group of MT systems evaluate the translation qualities of new systems? In this paper, we argue for the viability of a regression-based framework for sentence-level MTevaluation Through ... and Chris Brockett 2001 A machine learning approach to the automatic evaluation of machine translation In Proceedings of the 39th Annual Meeting of the Association for Computational Linguistics, ... Koehn 2006 Re-evaluating the role of BLEU in machine translation research In The Proceedings of the Thirteenth Conference of the European Chapter of the Association for Computational Linguistics...
- 8
- 476
- 0
Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc
... NSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA SGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEK GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ ... CGGGATCCCGGTTTCTTCTGAGGCTTCTCG CGGGATCCGGTGGCGCAGGCGG 83RGD -(as) 83RGD - (a) CGGGATCCCAGGGGTTTGATCACCGGTTT CGGGATCCACCGAACAGGGCGGGG 3'HVR5-(as) 5'HVR2-(s) GGCATGTAAGAAATATGAGTGTCTGGG CTCACGTATTTGGGCAGGCGCC a antisense, ... of the epitope is achieved [10,13-16] Strategies advancing this "capsid incorporation" paradigm have evaluated a range of virion capsid proteins as well as a variety of antigens, model and pathogenic...
- 13
- 419
- 0
Báo cáo hóa học: " Research Article A Refinement of Jensen’s Inequality for a Class of Increasing and Concave Functions" pptx
... proof for part a of Theorem 1.2 by showing the following lemma 8 Journal of Inequalities and Applications Lemma 1.3 For any integer n ≥ 1, and for all x1 , , xn with each xk ∈ a, b and all ... show that this is indeed true for all admissible q, t, and x1 For the case x1 a, ψ q 1/ 1−q ta Because ta ≤ b a, ψ q ≥ 1/ b a When a < x1 ≤ b, the value of ψ q approaches ∞ as q approaches ... maximum at x b Hence, π2 max − x∈ a, b f x −f a x a f x − f b −f a b a f b eb a − b a is a 2.13 Lemma 2.7 For < b − a < 2, eb a − ≥ 2− b a b a 2.14 Proof Note that, for < b − a < 2, 2.14 is equivalent...
- 14
- 373
- 0
Báo cáo toán học: "A Refinement of Cayley’s Formula for Trees" doc
... formula For the second formula, we note that L = − K −1 , and a formula for the coefficients of K −1 follows from (8.4) and (5.10) Applying Lemma 2.5 to Theorem 8.3 gives hook length formulas for ... h(v) of a vertex v in a forest is the number of descendants of v (including v) We will consider various kinds of trees and forests in this paper, and for each of them we will have a hook length formula ... and for a forest F we write asc F for the number of the electronic journal of combinatorics 11(2) (2006), #R27 18 ascents of F and des F for the number of descents of F (A different notion of...
- 23
- 228
- 0
Báo cáo y học: "Improved variant discovery through local re-alignment of short-read next-generation sequencing data using SRMA" pot
... Page 12 of 12 doi:10.1186/gb-2010-11-10-r99 Cite this article as: Homer and Nelson: Improved variant discovery through local re-alignment of short-read next-generation sequencing data using SRMA ... Local re-alignment of simulated data Local re-alignment of empirical data To assess the performance of local re-alignment on a dataset with a known diploid sequence, two whole genome human re -sequencing ... respectively, and after SRMA were 0.434, 0.538, and 0.328, respectively This demonstrates the ability of SRMA to improve variant calling, especially for indels To further examine the accuracy of the variant...
- 12
- 330
- 0
Analysis, design and optimization of energy efficient protocols for wireless sensor networks
... ANALYSIS, DESIGN AND OPTIMIZATION OF ENERGY EFFICIENT PROTOCOLS FOR WIRELESS SENSOR NETWORKS HOANG DUC CHINH (B.Eng., Hanoi University of Technology, Vietnam) A THESIS SUBMITTED FOR THE ... 21 1.3.4 Energy Efficient Routing and Optimization Methods in Wireless Sensor Networks 24 2.1 Introduction 24 2.2 Routing Protocols for Wireless Sensor Networks ... 3.2 43 Wireless Sensor Nodes’ Energy Model and Cluster Head Rotation for Balancing Energy 43 3.2.1 Energy Model of the Wireless Sensor Node ...
- 218
- 990
- 0
Comparative study on optimization of continuous countercurrent extraction for licorice roots
... Comminution of licorice roots for extraction 43 2.2 Soxhlet extraction 43 2.3 Coventional extraction by maceration 44 2.4 Horizontal screw continuous countercurrent extraction 45 iii TABLE OF CONTENTS ... characteristics of licorice roots comminuted by cut milling for extraction study 68 Table Results of Soxhlet extraction 73 Table 10 Results of the optimization study for continuous countercurrent extraction ... extraction 52 Table The extraction conditions investigated in the orthogonal experimental design for continuous countercurrent extraction 53 Table Extraction conditions used in the optimization of...
- 133
- 306
- 0
Báo cáo hóa học: " Effective Quality-of-Service Renegotiating Schemes for Streaming Video" ppt
... 36636, 37488, 38340 Effective Quality-of-Service Renegotiating Schemes for Streaming Video 287 Table 10: Performance comparison between the proposed algorithm and bandwidth renegotiating scheme (test ... Effective Quality-of-Service Renegotiating Schemes for Streaming Video [6] Z.-L Zhang, J Kurose, J D Salehi, and D Towsley, “Smoothing, statistical multiplexing, and call admission control for stored ... token bucket size, (b) packet loss rate, and (c) token drop rate Effective Quality-of-Service Renegotiating Schemes for Streaming Video 285 Table 1: Statistical properties of test MPEG trace files...
- 10
- 282
- 1
Treatment of semi-aerobic landfill leachate using durian peel-based activated carbon adsorption- Optimization of preparation conditions
... and 43% by using powdered activated carbon augmented activated sludge in landfill leachate Halim et al [7] studied a comparison study of ammonia and COD adsorption on zeolite, activated carbon and ... removal of organic substances were achieved at the addition of 50.0 g L−1 of activated carbon; remove up to 86% of COD and 63% of NH4+-N Kurniawan and Lo [11] reported that granular activated carbon ... remove about 60% of COD from leachate Studies of leachate by activated carbon adsorption have been reported by various authors [10, 12-15] Activated carbon is considered as one of the most effective...
- 14
- 612
- 0
Báo cáo Y học: Prediction of temporal gene expression Metabolic optimization by re-distribution of enzyme activities ppt
... protein to the enzyme catalysing the following reaction The last switch allocates a nite fraction of protein to all enzymes whereby the rst enzyme of the chain (which has already done most of its ễworkế ... accompanied by concerted changes in the mRNA levels for most enzymes of the central metabolism of yeast resulting in down-regulation of glycolysis and up-regulation of the TCA-cycle and gluconeogenesis ... or off enzyme activities at appropriate time points may lead to a signicant improvement of metabolic efciency For the linear reaction pathway of length n ẳ 10 the transition time achieved by optimal...
- 8
- 325
- 0
Báo cáo khoa học: "A TRIPARTITE PLAN-BASED MODEL OF DIALOGUE " pptx
... constructed domain plan Our tripartite model offers several advantages Ramshaw's model assumes that the top-level domain plan is given at the outset of the dialogue and then his model expands that plan ... in a plan-based discourse model In Proceedings of the 29th Annual Meeting of the ACL, Berkeley, CA, June 1991 [MP90] Conclusions We have presented a tripartite model of dialogue that distinguishes ... actions as well as being part of plans for other problem-solving actions Therefore, our Dialogue Model (DM) contains three levels of tree structures, one for each kind of action (discourse, problem-solving,...
- 8
- 186
- 0
báo cáo hóa học:" Research Article Optimization of an Image-Based Talking Head System" ppt
... animation and image-based rendering of models [5] Image-based facial animation can achieve more realistic animations, while 3Dbased approaches are more flexible to render the talking head in any view and ... drives the talking head The speech-driven talking head uses phoneme information from original sounds Text-driven talking head is flexible and can be used in many applications, but the quality of speech ... terms of naturalness The Mean Opinion Score (MOS) of our system was about 3.7 in the subjective test Conclusions We have presented the optimization of an image-based talking head system The image-based...
- 13
- 355
- 0
Từ khóa: applications of control charts arima for autocorrelated databias correction for the olse of the shape parameter for complete datacomplete the code for the do join method to support all of the join types supported in mysql hint you need to be able to identify the type of join before you begin optimization look to the parser for detailscciio s certification procedures for employment based plans and plan sponsor s use of federal fundstri objective optimization of a mtbe reactive distillation column a sensitivity based approachproposed strategic plan and implementation solutions of nic human resource consulting join stock company period 2013 2017using chunk based partial parsing of spontaneous speech in unrestricted domainstowards portable natural language interfaces to knowledge based the case of the orakel systemadaptation of the translation model for statistical machine translation based on information retrievaldesign optimization of cnc vertical milling machine bedmodeling simulation and optimization of industrial fixed bed catalytic reactorsenglish metaphoric expressions based on names of animalsmodelling simulation and optimization of industrial fixed bed catalytic reactors pdfpc based speed control of dc motor using pwm technique pdfexperiments based on conservation of energyBáo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngchuyên đề điện xoay chiều theo dạngNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANQuản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninhPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXChuong 2 nhận dạng rui roTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtBÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀMMÔN TRUYỀN THÔNG MARKETING TÍCH HỢPQUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ