controllable synthesis of zno architectures by a surfactant-free hydrothermal process
controllable synthesis of zno architectures by a surfactant-free hydrothermal process
... Controllable synthesis of ZnO architectures by a surfactant-free hydrothermal process Guixiang Du a, ⁎, Lidong Zhangb, Yan Feng a , Yanyan Xu a , YuXiu Sun a , Bin Ding a , Qian Wang a aCollege ... diameter in each tube has been rarelyreported in a surfactant-free hydrothermal pr ocess. When HMTA wasemployed, the hexagonal ZnO tubular bunches radially assembled by closely p acked n a notubes ... minutes and was transferred into 25 mLTeflon-lined stainless steel autoclaves, sealed and maintained at certaintemperature and time. After the reaction, the samples was filtered out,washed several...
- 3
- 411
- 0
controllable hydrothermal synthesis of zno nanowires arrays on al-doped zno
... www.elsevier.com/locate/apsusc Controllable hydrothermal synthesis of ZnO nanowires arrays on Al-doped ZnO seed layer and patterning of ZnO nanowires arrays via surface ... the ZnO- NWZenlarge extremely with the increase of the hydrothermal tempera-ture as compared to that of the ZnO- NWA. A reasonable explanationis that the ... regions of theAZO seed layer by the hydrothermal process. The structural properties of the ZnO NW arrays were char-acterized by using a D/max-2400 X-ray...
- 7
- 498
- 0
facile synthesis of zno micro-nanostructures with controllable morphology and
... Dang Li a , Xiangchao Zhangb, Jianlin Chen a , Shiying Zhangb a Department of Chemistry and Biological Engineering, Changsha University of Science and Technology, ... ZnO dandelions by a modified Kirkendall process. Jana et al. [18] prepared water lily-type ZnO flowers by a simple solution method, and Elias et al. [19] ... different samples. Table 1 indicatesthat the photoelectrochemical characteristics of the DSSC-baseddenser urchin-like ZnO are high, reaching a maximum value of 1.92%....
- 5
- 335
- 0
shape-controllable synthesis of ultrafine zno powders of different
... ultrafine crystalline of ZnO is a good example, which is anattractive material due to its wide variety of application includingpigments, catalysts and phosphors[3,4]. There are lots of ways ... hydroxide with analytic grade wereused as raw materials. Polyethylene glycol (PEG20000) withanalytic grade was used as dispersant agent. Distilled water wasobtained in laboratory.2.2. PreparationThe ... roomtemperature naturally. The product was centrifugated and washed by using distilled water repeatedly and using absolute ethanoltwice. Finally, the ultrafine ZnO powder was obtained by dryingin an...
- 5
- 369
- 0
Treatment of Textile Wastewater by a Coupling of Activated Sludge Process with Membrane Separation
... quality, and kinetic parameters were also investigated. Fig. 1. Schematic Diagram of the Coupling of Activated Sludge Process and Membrane Separation MATERIALS AND METHODS Wastewater ... Experimental Setup. A schematic diagram of the activated sludge process employed in this study is shown in Figure 1. The main unit consisted of an aeration tank and a microfiltration membrane as separation ... microorganism ratio (F/M ratio), sludge wastage rate, and sludge settling characteristic in sedimentation tank. An increase in biomass concentration will increase degradation rate and reduce the area...
- 8
- 434
- 0
Báo cáo khoa học: Heterologous synthesis of cytochrome c¢ by Escherichia coli is not dependent on the System I cytochrome c biogenesis machinery ppt
... mkriamitaltlcaaaahaDALKPEDKVKFRQAS mkhvlastaaglmalgl-assaiaAGLSPEEQIETRQAGmkklstlaalacmtvgsll-atsaqaQFAKPEDAVKYRQSA mrrvllatlmaalpaaaMAADAEHVVEARKGY(1) H. thermoluteolus(2) A. vinosum(3) A. ... FSLVALEFGPLAAM-AKGEMPYDAAAAKAHASDLVTLTKYDPSDLYAPGTSAD-DVKGTALKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEEVKPEFFQNMEDVGKIAREFVGAANTLAEVAATGEAEAVKTAFGDVGAACKSCHEKYRAK-ARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKKAKAAIWQDADGFQAKGMAFFEAVAALEPAAGAGQKE-LAAAVGKVGGTCKSCHDDFRVKR* ... FSLVALEFGPLAAM-AKGEMPYDAAAAKAHASDLVTLTKYDPSDLYAPGTSAD-DVKGTALKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEEVKPEFFQNMEDVGKIAREFVGAANTLAEVAATGEAEAVKTAFGDVGAACKSCHEKYRAK-ARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKKAKAAIWQDADGFQAKGMAFFEAVAALEPAAGAGQKE-LAAAVGKVGGTCKSCHDDFRVKR* ** * ** * * *Fig. 2. Multiple sequence analysis of biochemically characterized...
- 8
- 606
- 0
Báo cáo khoa học: Three-step hydroxylation of vitamin D3 by a genetically engineered CYP105A1 doc
... 7500E-mail: tsakaki@pu-toyama.ac.jpDatabaseStructural data are available in the ProteinData Bank database under the accessionnumbers 3CV8 and 3CV9(Received 14 May 2010, revised 1 July2010, accepted ... sites, was prepared using theprimers 5¢-ACCAAGCTTATGAAAAGATACCGCCAC-GACG-3¢ and 5 ¢-TTCTGCAGTCACCAGGTGACCGG-GAGTTCG- 3¢, and the expression plasmid forR73V ⁄ R8 4A in E. coli cells as a template ... Miyazaki A, Saito M, Adachi T, Mizoue K,Hanada K & Omura S (1992) Transformation of vita-min D3 to 1 alpha,25-dihydroxyvitamin D3 via25-hydroxyvitamin D3 using Amycolata sp. strains.Appl...
- 11
- 505
- 0
synthesis and growth of hematite nanodiscs through a facile hydrothermal approach
... wasprepared by depositing a few drops of a dilutesolution of the nanoparticles onto a mica discand then dried in air naturally. Analysis of theAFM image was performed using the WSxMsoftware ... nanoparticles by BET tech-nique, as shown in Fig. 10b. The measured curves forcalculating BET surface area of particles were plottedand analyzed. It can be seen that the surface area of a- Fe2O3nanodiscs ... nanoparticles are heavily dependenton the morphology and size, particle surface, andcrystallinity. As characterized above, the hematitenanodiscs achieved by a surfactant-free hydrothermal method show a...
- 17
- 623
- 0
Báo cáo khoa học: Cytosol–mitochondria transfer of reducing equivalents by a lactate shuttle in heterotrophic Euglena docx
... in aerobicpathways. Proc. Natl Acad. Sci. USA 85, 1888–1892.34. Takenaka, S., Kondo, T., Nazeri, S., Tamura, Y., Tokunaga, M.,Tsuyama, S., Miyatake, K. & Nakano, Y. (1997) Accumulation of trehalose ... intracellular lactate shuttle. Proc. NatlAcad. Sci. USA 96, 1129–1134.40. Valenti, D., de Bari, L., Atlante, A. & Pasarella, S. (2002)L-lactatetransport into rat heart mitochondria and ... sources,such as glu/mal,DL-lactate, orD-glucose. The variation inconcentrations of several relevant metabolites (D-lactate,L-lactate, pyruvate, paramylon, ATP) and carbon sourceswas determined....
- 10
- 287
- 0
Báo cáo Y học: Characterization of heparin binding by a peptide from amyloid P component using capillary electrophoresis, surface plasmon resonance and isothermal titration calorimetry ppt
... to tetra-saccharide, hexasaccharide, octasaccharide, decasaccharide,dodecasaccharide and tetradecasaccharide, and DUA is4-deoxy -a- L-threo-hexenopyranosyluronic acid), were pre-pared from ... sensorgram of regular (A) and scrambled (B) AP-1 peptide–heparin oligosaccharides interaction. The oligosaccharides shown are:(X2) tetrasaccharide (X3) hexasaccharide (X4) octasaccharide (X5)decasaccharide ... chip and empty bufferflows past the sensor surface again. The observed rateconstant, kobs,wasevaluatedfromeachtraceandusedtocalculate the association rate constant (kon). A plot of ksas a function...
- 8
- 347
- 0
Từ khóa: assessment of welded structures by a structural multiaxial fatigue approachdistinguishing random variables from variables created by a deterministic chaotic processthe synthesis of the modified tetrapyrrole known asd1haem requires several dedicated proteins which are coded for by a set of genes that are often found adjacent to the structural geneeach of which contain a transmembrane domain followed by a nucleotidebinding domainthe code offers a synthesis of the requirementswithin the balance of payments a current account deficit is offset by ain the balance of payments a current account surplus will be matched by ain the balance of payments statement a current account surplus will be matched by a trade surplusdiseases of the stomach and intestines are handled by a specialist in which systemthe disease known as severe acute respiratory syndrome sars is caused by a type ofa sense of wonder book by rachel carsonhow to find pressure exerted by a column of liquidfrom rags to riches a story of abu dhabi by mohammed al fahima history of english literature by arthur comptonricketta history of english literature by hudsonBáo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Nghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDEPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhPhát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Sở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namMÔN TRUYỀN THÔNG MARKETING TÍCH HỢPTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲQUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ