Báo cáo khoa học: Cloning, expression and characterization of a family-74 xyloglucanase from Thermobifida fusca pptx
Báo cáo khoa học: Cloning, expression and characterization of a new aspartate aminotransferase from Bacillus subtilis B3 docx
... kineticparameters Km, Vmax and kcatwere determined for thepurified AATB3. Values for Km and Vmaxfor bothamino donors (l-aspartate and l-glutamate) and ac-ceptors (a- ketoglutarate and oxaloacetate) ... mML-aspartatewas used as amino donor for a- ketoglutarate, and 30 mML-gluta-mate was used as amino donor for oxaloacetate. The activity of a- ketoglutarate was adjusted to 100.Identification of ... aspartateaminotransferase and its complex with maleate.Biochemistry 38, 2413–2424.11 Kim H, Nakaoka M, Yagi M, Ashida H, Hamada K,Shibata H & Sawa Y (2003) Cloning, structural analysis and expression...
- 13
- 490
- 0
Báo cáo khoa học: Cloning, expression and characterization of a family-74 xyloglucanase from Thermobifida fusca pptx
... Cloning, expression and characterization of a family-74 xyloglucanase from Thermobifida fusca Diana C. Irwin, Mark Cheng*, Bosong Xiang†, Jocelyn K. C. Rose‡ and David B. WilsonDepartment of ... Xeg74 was cloned into pET26b using theT. fusca Cel 6A signal sequence (MRMSPRPLRALLGAAAAALVSAAALAFPSQAA) in place of its nativesignal sequence. Cel 6A, Cel6Acd, and Cel4 8A have beenexpressed and ... byChirco & Brown [19] and Jung et al. [12]. Glucose and xylose oligomer standards were obtained from SeikagakuAmerica or Sigma.Preparation of GBG, GBX and tomato cell wallsBacterial cellulose...
- 9
- 453
- 0
Báo cáo Y học: Cloning, expression and characterization of a gene encoding nitroalkane-oxidizing enzyme from Streptomyces ansochromogenes pot
... sulfate fraction; lane 4, recombinant NaoA afterSephadex G75 chromatography; lane 5, purified recombinant NaoAafter DEAE-Sepharose Fast Flow chromatography; lane 6, standardmolecular mass markers ... b-lactoglobulin A, pI 5.1; myoglobin, pI6.8/7.2; trypsinogen, pI 9.3. The pI of NaoA was determined from a standard curve of pI and migration distance (cm) of protein standards.Enzyme assay and analytical ... completeDNA fragment can catalyze the oxidation of nitroalkanes.In this paper, we describe the cloning and characterization of a novel gene (naoA) that encodes nitroalkane-oxidizingenzyme in S. ansochromogenes.MATERIALS...
- 6
- 255
- 0
Báo cáo khoa học: Cloning, expression and interaction of human T-cell receptors with the bacterial superantigen SSA ppt
... 5¢-GGTTATCATATAAAGATCTCAAATTACCC-3¢, for the second PCRthe primers were: 5¢ primer, 5¢-GGGTAATTTGAGATCTTTATATGATAACC-3¢ and 3¢ primer, 5¢-CGCGCGGGATCCTTAGTGATGGTGATGGTGATGGGTGACCGGTTTTTTGGTAGGTGAAC-3¢.ThethirdPCRwascarried ... proliferation assayWe next analyzed the ability of recombinant SSA tostimulate human T-cells. All SSA preparations yieldedFig. 1. SDS/PAGE and immunoblotting analysis of SSA. (A) 12.5%SDS/PAGE of ... of radio-activity was then measured using a Liquid ScintillationAnalyzer 1600 TR (Packard, Canberra, Australia). Allmeasurements were made in triplicate.Binding analysisThe interaction of...
- 9
- 485
- 0
Tài liệu Báo cáo khoa học: Purification and characterization of a sialic acid specific lectin from the hemolymph of the freshwater crab Paratelphusa jacquemontii pdf
... Purification and characterization of a sialic acid specific lectin from the hemolymph of the freshwater crabParatelphusa jacquemontiiMaghil Denis, P. D. Mercy Palatty, N. Renuka Bai and S. Jeya SuriyaDepartment ... sialidasetypeX,proteaseenzymes and molecular mass standards were purchased from Sigma.Preparation of crab seraFreshwater field crabs, Paratelphusa jacquemontii werecollected from the local ... Denmark.47. Kamiya, H. & Ogata, K. (1982) Hemagglutinins in the acornbarnacle Balanus (Megabalanus roseus): purification and char-acterization. Nippon Suisan Gokkaishi 48, 1427.48. Kamiya,...
- 8
- 616
- 0
Tài liệu Báo cáo khoa học: Purification and characterization of a membrane-bound enzyme complex from the sulfate-reducing archaeon Archaeoglobus fulgidus related to heterodisulfide reductase from methanogenic archaea pdf
... with anapparent molecular mass of 53 kDa appears as a double band inunboiled samples (lanes A1 and B1).Table 1. N-Terminal sequences of the polypeptides of the purified enzyme. N-Terminal sequen ... of AF499 was identified asan archaeal promoter element by seque nce analysis. The sequ ence AAAGGTTAATATA shows a high le vel of identity with th e consensus se quence()35 to )23, AAANNNTTATATA) ... catalyticsubunit of Hdr from methanogenic archaea have beendeposited in the databases. None of these putative pro teinshas b een c haracterized and no f unction has been assigned toany of...
- 10
- 564
- 0
Báo cáo khoa học: Identification and characterization of a nuclear receptor subfamily I member in the Platyhelminth Schistosoma mansoni (SmNR1) pot
... bp wasproduced by PCR amplification with TOPO 2.1-SmNR1 as a template (forward primer: 5¢-ATTTCAGAAGTTGAACAAACACAC-3¢, reverse primer: 5¢-AAGATGGTATTGAAGATGATGGTTGA-3¢), purified from agarose ... DR2:5¢-CCGTAAGGTCACAAGGTCACTCG-3¢,DR3:5¢-CCGTAAGGTCACAGAGGTCACTCG-3¢, DR4: 5¢-CCGTAAGGTCACAGGAGGTCACTCG-3¢, DR5: 5¢-CCGTAAGGTCACCAGGAGGTCACTCG-3¢. PAL0: 5¢-CGCAAGGTCATGACCTCG-3¢. One strand of each oligonucleotide ... Extraction kit (Qiagen, Valencia, CA, USA) and randomly labeled with32P using a Metaprime kit (Amer-sham Pharmacia Biotech Inc., Piscataway, NJ, USA). ForBAC DNA sequencing, the BAC clone was...
- 16
- 542
- 0
Báo cáo khoa học: Identification and characterization of 1-Cys peroxiredoxin from Sulfolobus solfataricus and its involvement in the response to oxidative stress pdf
... 25–29.12 Kawakami R, Sakuraba H, Kamohara S, Goda S,Kawarabayasi Y & Ohshima T (2004) Oxidative stressresponse in an anaerobic hyperthermophilic archaeon:presence of a functional peroxiredoxin ... the first of all Prxs analysedso far in archaea that has only one cysteine residue inthe sequence.Transcriptional analysis of bcp2 under oxidativestress and characterization of mRNA 5¢ endIn ... Garrett RA (2005) Diver-gent transcriptional and translational signals inArchaea. Environ Microbiol 7, 47–54.17 Bell SD (2005) Archaeal transcriptional regulation – vari-ation on a bacterial theme?...
- 11
- 565
- 0
Báo cáo khoa học: Identification and characterization of a collagen-induced platelet aggregation inhibitor, triplatin, from salivary glands of the assassin bug, Triatoma infestans ppt
... Identification and characterization of a collagen-inducedplatelet aggregation inhibitor, triplatin, from salivaryglands of the assassin bug, Triatoma infestansAkihiro Morita1, Haruhiko Isawa2, ... Western blot analysis of triplatin-1 and -2 from the salivarygland of T. infestans. Extracts from a pair of salivary glands, recom-binant triplatin-1 and recombinant triplatin-2 were separated by15% ... clonesSalivary glands of T. infestans were dissected from thoraces of unfed adults, and poly A( +) RNA was isolated from 30pairs of salivary glands using a MicroPrep mRNA isolationkit (Amersham Pharmacia...
- 8
- 408
- 0
Báo cáo Y học: Identification and characterization of a new gene from Variovorax paradoxus Iso1 encoding N -acyl-D-amino acid amidohydrolase responsible for D-amino acid production pdf
... Ishikara, T. & Fukagawa, Y. (1980) Deacetylation of PS-5, a new beta-lactam compound III. Enzymological char-acterization of L-amino acid acylase and D-amino acid acylase from Pseudomonas ... xylosoxydans A- 6 N-acyl-D-glutamate amidohydrolase; Alicaligenesfaecalis-DA1: Alcaligenes faecalis DA1N-acyl–D-amino acid amidohydrolase;V. paradoxus Iso1: Variovorax paradoxusIso1 N-acyl-D-amino ... upstream of the N-D-AAase gene is:5¢…AGGACAGACGAATG…3¢ (The Shine-Dalgarnosequence and start codon are in bold). The recombinantplasmid was named pTrc 2A- damA3 without His-tag. Expression and...
- 11
- 656
- 0
Từ khóa: Báo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Nghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDEPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọTrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Phát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngĐịnh tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)Đổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namQUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ