Báo cáo khoa học: Cloning, characterization and localization of a novel basic peroxidase gene from Catharanthus roseus potx

... basic peroxidase gene from Catharanthus roseus Santosh Kumar, Ajaswrata Dutta, Alok K. Sinha and Jayanti SenNational Centre for Plant Genome Research, JNU Campus, Aruna Asaf Ali Marg, New Delhi, India Catharanthus ... database, i.e.Avicennia (BAB16317), Nicotiana secretory peroxidases (AAD33072), cotton (COTPROXDS) (AAA99868), barley grain (BP1) (AAA32973),Ar. thaliana (ATP 2A) A2 (Q42578) and HRP-C (AAA33377). ... (2002)Analysis and expression of the class III peroxidase large gene family in Arabidopsis thaliana. Gene 288, 129–138.25 Tanaka S, Ikeda K, Ono M & Miyasaka H (2002) Isola-tion of several anti-stress...

Tài liệu Báo cáo khoa học: Cloning, characterization and expression analysis of interleukin-10 from the common carp, Cyprinus carpio L. docx

... GAGGCTAGATACTGCTCGATGTIL-10 forward3 TGATGATTTGGAACCATTATTGAAIL-10 reverse3 CACCTTTTTCCTTCATCTTTTCATb-Actin forward1 ACTACCTCATGAAGATCCTGb-Actin reverse1 TTGCTGATCCACATCTGCTGT7- forward TAATACGACTCACTATAGGGSP6-reverse ... Cloning, characterization and expression analysis of interleukin-10 from the common carp,Cyprinus carpioL.Ram Savan1, Daisuke Igawa2 and Masahiro Sakai21United Graduate School of Agricultural ... study.Cloning and characterization of the carp IL-10 gene A carp cDNA library, produced following stimulation withconcanavalin A and LPS [18], was used to isolate the IL-10 gene, employing IL-10-Fw2 and...

Báo cáo khoa học: Cloning, expression and interaction of human T-cell receptors with the bacterial superantigen SSA ppt

... 5¢-GGTTATCATATAAAGATCTCAAATTACCC-3¢, for the second PCRthe primers were: 5¢ primer, 5¢-GGGTAATTTGAGATCTTTATATGATAACC-3¢ and 3¢ primer, 5¢-CGCGCGGGATCCTTAGTGATGGTGATGGTGATGGGTGACCGGTTTTTTGGTAGGTGAAC-3¢.ThethirdPCRwascarried ... proliferation assayWe next analyzed the ability of recombinant SSA tostimulate human T-cells. All SSA preparations yieldedFig. 1. SDS/PAGE and immunoblotting analysis of SSA. (A) 12.5%SDS/PAGE of ... of radio-activity was then measured using a Liquid ScintillationAnalyzer 1600 TR (Packard, Canberra, Australia). Allmeasurements were made in triplicate.Binding analysisThe interaction of...

Báo cáo khoa học: Identiﬁcation and localization of glycine in the inner core lipopolysaccharide of Neisseria meningitidis ppt

... data, the majority of structural analyseson meningococcal core oligosaccharides had been per-formed following O-deacylation and/ or dephosphorylation.Naturally, base-labile residues that may ... Identiﬁcation and localization of glycine in the inner corelipopolysaccharide of Neisseria meningitidisAndrew D. Cox, Jianjun Li and James C. RichardsInstitute for Biological Sciences, National ... identify and structurallycharacterize the presence of ester-linked glycine residues inthe core oligosaccharide of meningococcal LPS.MATERIALS AND METHODSGrowth of organism and isolation of LPSN....

Báo cáo khoa học: Puriﬁcation and properties of a new S-adenosyl-Lmethionine:ﬂavonoid 4¢-O-methyltransferase from carnation (Dianthus caryophyllus L.) pot

... compo-nents of each reaction mixture, after their chromatographicseparation and puriﬁcation, were submitted to1HNMR(nuclear magnetic resonance) and FABMS (fast atombombardment mass spectrum) analyses ... Theconcentration of both the assayed compound and itsrespective transformation product was determined bycomparison of peak data with those obtained from authentic standards chromatographed at different ... S-Adenosyl-L-methionine:ﬂavonoid 4¢-O-methyltransferase crude activity in healthy and inoculated tissues of the carnation cultivar ¢Novada¢.In each row, values followed by a same number of * are not statistically...

Báo cáo khoa học: Proper targeting and activity of a nonfunctioning thyroid-stimulating hormone receptor (TSHr) combining an inactivating and activating TSHr mutation in one receptor pptx

... Dickinson and Co.) was usedto acquire and analyze data. A minimum of at least 10 000cells was analyzed.Computation of specific constitutive activity (SCA) and relative SCA (RSCA)Given that the transfection ... 5-isothiocyanate and PI. Fluorescence emission of fluorescin 5-isothiocyanate and PI from single cells were separated and measured usingthe standard optics of the FACSort. TheCELLQUESTsoftware program ... constitutive activityThe data obtained from the FACS analysis allowedmeasurement of efficiency of transfection and computation of the increase in cAMP and IP within the effectivelytransfected cells. Assuming...

Báo cáo khoa học: Structural features and dynamics of a cold-adapted alkaline phosphatase studied by EPR spectroscopy docx

... The activity in thestandard assay and EPR spectra of the spin-labeled WT AP weremeasured after incubation in urea. The scaled mobility factor (Ms)was calculated from the central linewidth of ... reduce catalytic activity of a cold-adapted alkaline phosphatase. Biochim Biophys Acta1774, 679–687.32 Janeway CML, Xu X, Murphy JE, Chaidaroglou A &Kantrowitz ER (1993) Magnesium in the active ... mobility that are relevant to the catalyticreaction pathway in APs.Experimental proceduresCloning and mutagenesisThe Vibrio AP gene was ampliﬁed by standard PCRmethods from the pBAS20 (pBluescript...

Báo cáo khoa học: Analyzing the catalytic role of Asp97 in the methionine aminopeptidase from Escherichia coli potx

... 2008)doi:10.1111/j.1742-4658.2008.06749.xAn active site aspartate residue, Asp97, in the methionine aminopeptidase(MetAPs) from Escherichia coli (EcMetAP-I) was mutated to alanine, glu-tamate, and asparagine. Asp97 is the lone carboxylate ... heat of dilution, via an iterative processusing the origin software package. This software pack-age uses a nonlinear least-square algorithm that allowsthe concentrations of the titrant and ... of this conserved aspartate in human prolidase by aspara-gine causes skin abnormalities, recurrent infections, and mental retardation [45].On the basis of ICP-AES analyses, both D9 7A EcMetAP-I...

Báo cáo khoa học: Cloning, expression and characterization of a new aspartate aminotransferase from Bacillus subtilis B3 docx

... kineticparameters Km, Vmax and kcatwere determined for thepuriﬁed AATB3. Values for Km and Vmaxfor bothamino donors (l-aspartate and l-glutamate) and ac-ceptors (a- ketoglutarate and oxaloacetate) ... mML-aspartatewas used as amino donor for a- ketoglutarate, and 30 mML-gluta-mate was used as amino donor for oxaloacetate. The activity of a- ketoglutarate was adjusted to 100.Identiﬁcation of ... and Asp, and the formation of Asp is used to generateseveral essential amino acids such as Asn, Met, Thr,Lys and Ile. AATs regenerate the carbon skeletonsKeywordsaspartate aminotransferase;...

Báo cáo khoa học: Cloning, expression and characterization of a family-74 xyloglucanase from Thermobiﬁda fusca pptx

... puriﬁcationThe gene for Xeg74 was cloned into pET26b using theT. fusca Cel 6A signal sequence (MRMSPRPLRALLGAAAAALVSAAALAFPSQAA) in place of its nativesignal sequence. Cel 6A, Cel6Acd, and Cel4 8A have ... byChirco & Brown [19] and Jung et al. [12]. Glucose and xylose oligomer standards were obtained from SeikagakuAmerica or Sigma.Preparation of GBG, GBX and tomato cell wallsBacterial cellulose ... included a glucose standardcurve. The average molecular mass of the XG oligosaccha-rides (XGOs) was calculated from the manufacturer’s data and was found to be 1293 Da. This value agreed with...

Xem thêm