Báo cáo khoa học: MicroRNAs – micro in size but macro in function Sunit K Singh1,2, Manika Pal Bhadra3, Hermann J Girschick2 and Utpal Bhadra4 pptx

Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx

... study,BA150100500 –5 0 –1 00 –1 50 –2 00 –2 50 –3 00 –3 50Time (min) Influx Efflux WT (MS) WT (LK) helps (MS) helps (LK)OE6 (MS) OE6 (LK) 0 1 2345Net K + flux (pmol⋅cm –2 s –1 )⋅150100500 –5 0 –1 00 –1 50 –2 00 –2 50 –3 00aabcbaaEfflux ... levels of AKT1, CBL1, CBL9 and CIPK23 in the 2-week-oldwide-type, helps mutant and OE line seedlings on normal Murashi-ge and Skoog (MS) plates and in a medium containing 100 lM K +(LK). Gene ... alreadybeen identiﬁed, such as KAT1, AtKCO1, AtHKT1, and HAK1 ⁄ 5 [6,4 7–4 9], it is assumed that a numberof genes involved in regulating K +uptake and K +transport remain unknown.Our results revealed...

Tài liệu Báo cáo khoa học: MicroRNAs and epigenetics doc

... proto-oncogene and thedownstream extracellular signal-regulated kinase 2(ERK2). J Biol Chem 283 , 1815 8–1 8166.91 Grady WM, Parkin RK, Mitchell PS, Lee JH, KimYH, Tsuchiya KD, Washington MK, Paraskeva ... genetic and epi-genetic association study and functional analysis.Cancer Res 69, 597 0–5 977.90 Kim S, Lee UJ, Kim MN, Lee EJ, Kim JY, Lee MY,Choung S, Kim YJ & Choi YC (2008) MicroRNAmiR-199a* ... broadly in uences gene expression and promotes apoptosis. Mol Cell 26, 74 5–7 52.39 Lodygin D, Tarasov V, Epanchintsev A, Berking C,Knyazeva T, Korner H, Knyazev P, Diebold J & Her-meking H...

Tài liệu Báo cáo khoa học: MicroRNAs and cardiovascular diseases ppt

... Herrick SE & Lindsay MA (2010) MicroRNAs and the regulation of ﬁbrosis. FEBS J 277, 201 5–2 021.15 Wang GK, Zhu JQ, Zhang JT, Li Q, Li Y, He J, QinYW & Jing Q (2010) Circulating microRNA: ... JD, Yoshino O,Lin S & Han J (2008) Impaired microRNA processingcauses corpus luteum insufﬁciency and infertility in mice. J Clin Invest 118, 194 4–1 954.20 Giraldez AJ, Cinalli RM, Glasner ... (Continued)miRNA TargetsGenesymbol Function Binding site in mouseConservation in mouseBinding sites in humanConservation in humanSNPs(dbSNP) ReferencesmiR-221 ⁄ 222 p27(Kip1) CDKN1B Inhibition...

Tài liệu Báo cáo khoa học: Homologous expression of the nrdF gene of Corynebacterium ammoniagenes strain ATCC 6872 generates a manganese-metallocofactor (R2F) and a stable tyrosyl radical (Y•) involved in ribonucleotide reduction ppt

... 62 5–6 33.52 Stoer J (2005) Stoer, Josef, Bd.1: Numerische Mathema-tik. Springer, Berlin.53 Heffeter P, Popovic-Bijelic A, Saiko P, DornetshuberR, Jungwirth U, Voevodskaya N, Biglino D, JakupecMA, ... Environ Microbiol 60, 75 6–7 59.16 Wohlleben W, Muth G & Kalinowski J. (1993) GeneticEngineering of Gram-positive bacteria. In Genetic Engi-neering of Microorganisms (Pu¨hler A ed), pp 8 3–1 33.Wiley-VCH, ... L, Lima MJ, Ascenso CS, Czaja C,Moura I, Moura JJG & Rusnak F (1998) Metal bindingto the tetrathiolate motif of desulforedoxin and relatedpolypeptides. J Biol Inorg Chem 3, 64 3–6 49.32...

Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

... DIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAADSGQGHANS .:* *:**.**:**** *:***::::*. : * * ::* . . Alpha N AKSSDKEEKHRK Beta EGP-GSKTGDKEEKHRK Gamma N KTLEKMEKHRK Epsilon K ASEKDAKHRK Delta EKAPLRKTSEAAVKEGKTEKTD ... downre-gulating in ammation and Th1 response. PLoS ONE 2,e1071, doi:10.1371/journal.pone.0001071.41 Karjalainen JM, Kellokoski JK, Mannermaa AJ,Kujala HE, Moisio KI, Mitchell PJ, Eskelinen MJ,Alhava ... 277,663 7–6 644.47 Pellikainen JM & Kosma VM (2007) Activator protein-2 in carcinogenesis with a special reference to breastcancer – a mini review. Int J Cancer 120, 206 1–2 067.48 Karsenty...

Tài liệu Báo cáo khoa học: Molecular defect of isovaleryl-CoA dehydrogenase in the skunk mutant of silkworm, Bombyx mori ppt

... silkworm(sku ⁄ +sku) and the skunk mutant (sku ⁄ sku)at (A) day 2 of ﬁfth instar and (B) 10 daysafter spinning. Until spinning, the skunkmutant larva develops normally (A). Afterspinning, ... genes in insect cells. In Inverte-brate Cell System Application (Mitsuhasi J ed), pp. 16 7– 181. CRC Press, Boca Raton, FL.26 Mita K, Morimyo M, Okano K, Koike Y, Nohata J, Kawasaki H, Kadono-Okuda ... existing in faeces from the skunk silkworm,Bombyx mori. J Sericult Sci Japan 47, 16 1–1 65.6 Inokuchi T & Yoshitake N (1978) Abnormality ofamino acid metabolism in the mutant-skunk of the K. ...

Tài liệu Báo cáo khoa học: Suppressed catalytic efﬁciency of plasmin in the presence of long-chain fatty acids Identiﬁcation of kinetic parameters from continuous enzymatic assay with Monte Carlo simulation ppt

... K m¼ k À1 k 2ðÞ :k 3 k 1 k 2 k 3ðÞ, k p¼ k 2 :k 3 k 2 k 3 and the equilibrium associa-tion constant for the product K i¼ k À3 k 3. Although the K m and the k pderived for Model I and ... þ K mð1 þ S0 K iÞ k pÁEt0lnS0S0À P: ð4ÞIt can be proved that t in Eqn (4) is a strictly increasing function of P for any combination of K m, k p and K i and therefore it has an inverse ... ð1Þwhere Et0 and S0are the initial concentrations of plasmin and its substrate, the Michaelis constant K m¼ k À1 k 2 k 1 and the cata-lytic constant k p= k 2[12]. Following integration...

Tài liệu Báo cáo khoa học: Molecular determinants of ligand speciﬁcity in family 11 carbohydrate binding modules – an NMR, X-ray crystallography and computational chemistry approach doc

... hydrophobic and polar residues in ligand binding in the family 15carbohydrate-binding module from Cellvibrio japonicusXyn10C. Biochemistry 42, 931 6–9 323.12 Xie HF, Gilbert HJ, Charnock SJ, Davies GJ, ... for screening and identifying ligand binding toprotein receptors. Angewandte Chemie-International Edi-tion 42, 86 4–8 90.16 Mayer M & Meyer B (1999) Characterization of ligandbinding by saturation ... 31 9–3 31.21 Klein J, Meinecke R, Mayer M & Meyer B (1999)Detecting binding afﬁnity to immobilized receptor pro-teins in compound libraries by HR-MAS STD NMR. J Am Chem Soc 121, 533 6–5 337.22...

Tài liệu Báo cáo khoa học: Molecular aspects of rheumatoid arthritis: chemokines in the joints of patients pdf

... and IFN-c. (B) Chemokines expressed in the joint recruit leukocytes intothe joints. In addition to functioning in cell trafﬁcking, severalchemokines have other biological abilities. Chemokines ... Chemokines–chemotactic cytokinesthat mediate in ammation. N Engl J Med 338, 43 6–4 45.5 Kelner GS, Kennedy J, Bacon KB, Kleyensteuber S,Largaespada DA, Jenkins NA, Copeland NG, BazanJF, Moore KW, ... DC,Katschke KJ Jr, Woods JM, Park CC, Morel JC &Koch AE (2001) Fractalkine, a novel chemokine in rheumatoid arthritis and in rat adjuvant-induced arthri-tis. Arthritis Rheum 44, 156 8–1 581.44...

Tài liệu Báo cáo khoa học: Glycation of low-density lipoprotein results in the time-dependent accumulation of cholesteryl esters and apolipoprotein B-100 protein in primary human monocyte-derived macrophages docx

... (2001) Abnormalities in apoB-containing lipoproteins in diabetes and atherosclero-sis. Diabetes Metab Rev 17, 2 7–4 3.11 Lyons TJ & Jenkins AJ (1997) Lipoprotein glycation and its metabolic ... (1997)Increased accumulation of the glycoxidation productN(epsilon)-(carboxymethyl) lysine in human tissues in diabetes and aging. J Clin Invest 99, 45 7–4 68.21 Sakata N, Imanaga Y, Meng J, Tachikawa ... Ne-carboxymethyl-lysines and Ne-carboxy-ethyl-lysines and pentosidine) being known to accumu-late with age on tissue proteins, and at an increasedrate in LDL and atherosclerotic lesions in peoplewith...

Xem thêm

Từ khóa: Báo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018 Báo cáo quy trình mua hàng CT CP Công Nghệ NPV Nghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt nam Nghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấp Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDE Quản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninh Phát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninh Phát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ long Nghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000 Định tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Thơ nôm tứ tuyệt trào phúng hồ xuân hương Kiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Trách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)Đổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt nam HIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM MÔN TRUYỀN THÔNG MARKETING TÍCH HỢP