0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Báo cáo khoa học: "LANGUAGE SYNTHESIS GENERATION OF GERMAN FROM CONCEPTUAL STRUCTURE: MT PROJECT IN A JAPANESE/GERMAN" pot

Báo cáo khoa học:

Báo cáo khoa học: "LANGUAGE SYNTHESIS GENERATION OF GERMAN FROM CONCEPTUAL STRUCTURE: MT PROJECT IN A JAPANESE/GERMAN" pot

... LANGUAGE GENERATION FROM CONCEPTUAL STRUCTURE: SYNTHESIS OF GERMAN IN A JAPANESE /GERMAN MT PROJECT J. Laubsch, D. Roesner, K. Hanakata, A. Lesniewski Projekt SEMSYN, Institut fuer Informatik, ... representation as an interlingua in a practical application will be investigated and demonstrated by translating titles of Japanese papers from the field of "Information Technology". This material ... Winograd's terminology for functional gran~nar (Winograd, 1983). In general, case schemata will be mapped into CLAUSE-RS and concept schemata are mapped into NP-R~. A CLAUSE-RS has a...
  • 4
  • 358
  • 0
Báo cáo khoa học: The catalytic role of the distal site asparagine-histidine couple in catalase-peroxidases potx

Báo cáo khoa học: The catalytic role of the distal site asparagine-histidine couple in catalase-peroxidases potx

... Catalase-peroxidases have a predo-minant catalase activity but differ from monofunctionalcatalases in also exhibiting a substantial peroxidatic activitywith broad specificity. However, no substantial catalaseactivity ... mutated. The flanking primerswere 5¢-AATGATCAGGTACCGGCCAGTAAATG-3¢containing a KpnI restriction site and 5¢-TGCATAAAGGATCCGGGTGC-3¢ containing a BamHI restriction site.The following mutant primers ... and 5¢-CCAGGAATTCAGGGGGGCGAAGC-3¢ introduced the restriction site EcoRI andchanged Asn153 to Ala; 5¢-CCTGAATTCCTGGCCAGATGACGTCAATTTAGAC-3¢ and 5¢-CCAGGAATTCAGGGGGGCGAAGC-3¢ introduced the...
  • 8
  • 290
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "The Incremental Generation of Passive Sentences" pot

... auxil- iary is treated as an argument-attraction verb (cf. Hinrichs & Nakazawa 1991): It subcategorizes for a passive participle and attracts the arguments that the par- ticiple subcategorizes ... access, also affected the choice of verbal voice. 9 in an actional event type. (Technically, the relevant embedding information is available via coindexing of the semantics of the already integrated ... other approaches to the computational modelling of empirically substantiated features of human language production, such as Kempen & Hoenkamp's (1987) Incremental Procedural Grammar and...
  • 9
  • 379
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Language Identification of Search Engine Queries" pdf

... by automat-ically generating a data set of queries with lan-guage annotations. We show that the data gener-ated this way is highly reliable and can be used totrain a machine learning algorithm.We ... geographicalinformation of the users.Human annotations on 5000 automatically an-notated queries showed that our data generation method is highly accurate, achieving 84.3% accu-racy on average ... andwithout the new feature, using a training data size of 10,000 instances, and display the results in Ta-ble 6. We also show the contribution of the newfeature as a standalone classifier in...
  • 9
  • 453
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Data-driven Generation of Emphatic Facial Displays" pptx

... was recorded, and the facialdisplays used by the speaker were anno-tated. The data from those recordings wasused in a range of models for generatingfacial displays, each model making use of a ... describe an implementation of data-driven selection of emphatic facial dis-plays for an embodied conversationalagent in a dialogue system. A corpus of sentences in the domain of the target dia-logue ... generation system. In order to make a more sophisticated and naturalis-tic selection of facial displays, we recorded a sin-gle speaker reading a set of sentences drawn from the COMIC domain, and...
  • 8
  • 312
  • 0
Tài liệu Báo cáo khoa học: Altered inactivation pathway of factor Va by activated protein C in the presence of heparin doc

Tài liệu Báo cáo khoa học: Altered inactivation pathway of factor Va by activated protein C in the presence of heparin doc

... consists of a 105 kDa heavy (A1 and A2 domains)and a 71–74-kDa light (A3 , C1, and C2 domains) chainwhich are noncovalently associated.During APC-catalyzed inactivation of FVa, the heavychain of ... cleavage at Arg506 iskinetically favored over that at Arg306 and results in theformation of an inactivation intermediate (FVaint), whichretains partial FVa cofactor activity owing to its ability ... (1997)Anticoagulant synergism of heparin and activated protein C in vitro. Role of a novel anticoagulant mechanism of heparin,enhancement of inactivation of factor V by activated protein C.J. Clin....
  • 13
  • 654
  • 0
Tài liệu Báo cáo khoa học: Models and mechanisms of O-O bond activation by cytochrome P450 A critical assessment of the potential role of multiple active intermediates in oxidative catalysis doc

Tài liệu Báo cáo khoa học: Models and mechanisms of O-O bond activation by cytochrome P450 A critical assessment of the potential role of multiple active intermediates in oxidative catalysis doc

... action of superoxide dismutase or catalase, implicating theinvolvement of a peroxo adduct in catalysis [243]. In fact,reactivity was enhanced when H2O2was the oxidant in p lace of reductant and ... [106,107]. A step forward in the analysis of Fe(III)-OO(H) as a potential catalyst was thought to be offered by the use o fmutated P450s, bearing alanine or some other amino acid in place of t he ... competitionbetween a spin-paired low-spin ensemble and a nonspin-paired high-spin manifold, with state crossing being asso-ciated with either an insertion or a radicalar pathway,permitting the formation of...
  • 26
  • 746
  • 0
Tài liệu Báo cáo khoa học: The molecular surface of proteolytic enzymes has an important role in stability of the enzymatic activity in extraordinary environments pptx

Tài liệu Báo cáo khoa học: The molecular surface of proteolytic enzymes has an important role in stability of the enzymatic activity in extraordinary environments pptx

... 5¢-TAATATTGACcCCgGGCGCCAcAATCTCAAG-3¢ SmaIY259Q 5¢-GCCATTTCCATAtTgaGTaCTGTTACCAAG-3¢ ScaID266N 5¢-CATACTCAGCgTtaACTAAGCCATTTC-3¢ HpaIY26 9A 5¢-TTGAGCCGCAgcCTCAGCgTCgAC TAAGCCATTTC-3¢ SalIQ272R 5¢-CTTAGGGATTAacGAGCCGCATACTCAGCgTCgAC ... GGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYLGNSFYYGKGLINVQAAAQJ 211 GGTYGAYNGTSMATTHVAGAAALILSKHPTWTNAQVRDRLESTATYLGNSFYYGKGLINVQAAAQAMYL 211 GGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYLGNSFYYGKGLINVQAAAQBPN' 211 GNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQMECE ... SATSRGVLVVAASGNSGA-GSIS YPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYP221 139 SATSRGVLVVAASGNSGA-GSIS YPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPSAVI 138 SATSRGVLVVAASGNSGA-GSIS YPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPSEND...
  • 9
  • 489
  • 0
Báo cáo khoa học: Mechanisms and kinetics of human arylamine N-acetyltransferase 1 inhibition by disulfiram potx

Báo cáo khoa học: Mechanisms and kinetics of human arylamine N-acetyltransferase 1 inhibition by disulfiram potx

... [9–11].Arylamine N-acetyltransferases (NATs) are phase 2XMEs that catalyse the transfer of an acetyl group from acetyl-coenzyme A (AcCoA) to the nitrogen oroxygen atom of primary arylamines, hydrazines andtheir ... with bovine serumalbumin as a standard.Enzyme assaysRecombinant NAT1 enzyme activity was determined spec-trophotometrically using PNPA as the acetyl donor andPAS as the arylamine substrate [45]. ... concentration determined andassayed for NAT1 activity using 2-aminofluorene.Expression and purification of recombinanthuman NAT1Human NAT1 was expressed as a 6 · His-tagged protein in Escherichia...
  • 9
  • 456
  • 0
Báo cáo khoa học: Actin-binding domain of mouse plectin Crystal structure and binding to vimentin pot

Báo cáo khoa học: Actin-binding domain of mouse plectin Crystal structure and binding to vimentin pot

... subdomain of its ABD. Weshow that vimentin binds to this site via the amino-terminalpart of its rod domain. This additional amino-terminalintermediate filament protein binding site of plectin mayhave ... cytolinker protein, iscomposed of several subdomains that harbor binding sitesfor a variety of different interaction partners. A canonicalactin-binding domain (ABD) comprising two calponinhomology ... domains, CH1 andCH2. This relatively small domain ( 30 kDa) is found in many actin-binding and cytolinker proteins, such as a- actinin, dystonin, fimbrin, spectrin/fodrin, dystrophin andutrophin,...
  • 12
  • 477
  • 0

Xem thêm

Từ khóa: báo cáo khoa họcbáo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpBáo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngBáo cáo quy trình mua hàng CT CP Công Nghệ NPVNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiNghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấpđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANQuản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninhPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngĐịnh tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtchuong 1 tong quan quan tri rui roGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)MÔN TRUYỀN THÔNG MARKETING TÍCH HỢP