0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a coupled oscillator-based mechanism in smooth muscle ppt

Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a coupled oscillator-based mechanism in smooth muscle ppt

Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a coupled oscillator-based mechanism in smooth muscle ppt

... of Physiology and Pharmacology, University of Calgary, Alberta, Canada2 School of Biomedical Sciences, University of Newcastle, Callaghan, NSW, AustraliaLong-range signalingBiological organs ... 2009)doi:10.1111/j.1742-4658.2009.07437.xEntrained oscillations in Ca2+underlie many biological pacemaking phe-nomena. In this article, we review a long-range signaling mechanism in smooth muscle that results in global outcomes of ... depolarizations that drive rhythmic contractions of lymphatic smooth muscle. The main feature of this signaling mechanism is a coupled oscillator-based synchronization of Ca2+oscillations across...
  • 8
  • 709
  • 0
Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a capacitative (AC) electrical coupling model in neuroepithelium pptx

Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a capacitative (AC) electrical coupling model in neuroepithelium pptx

... cadherin–catenin complexesThe cytoplasmic domain of cadherin interacts withF-actin via b-catenin and a- catenin; b-catenin bindsto cadherin and a- catenin, which in turn interacts withF-actin (Fig. ... is activated by an increase in intracellu-lar [Ca2+] [29,30].If Pyk2 is transiently activated by an increase in intracellular [Ca2+] to phosphorylate b-catenin in twoDevelopment of neural ... MINIREVIEW Synchronization of Ca2+ oscillations: a capacitative (AC)electrical coupling model in neuroepitheliumMasayuki YamashitaDepartment of Physiology I, Nara Medical University, Kashihara,...
  • 7
  • 641
  • 0
Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: involvement of ATP release in astrocytes pdf

Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: involvement of ATP release in astrocytes pdf

... MINIREVIEW Synchronization of Ca2+ oscillations: involvement of ATPrelease in astrocytesSchuichi KoizumiDepartment of Pharmacology, Faculty of Medicine, University of Yamanashi, JapanIntroductionGlia, ... machinery isinvolved in glutamate release in astrocytes, althoughnonvesicular mechanisms for glutamate release havealso been proposed. In contrast, the mechanismsunderlying the release of ... intercellular Ca2+waves by a mechanism of chemical coupling mediated by ATP. In both cases, an increase in [Ca2+]iis driven by neuronal activities. (c) Astrocytic Ca2+transients also affect...
  • 7
  • 549
  • 0
Tài liệu Báo cáo khoa học: Kinetics of dextran-independent a-(1 fi 3)-glucan synthesis by Streptococcus sobrinus glucosyltransferase I pdf

Tài liệu Báo cáo khoa học: Kinetics of dextran-independent a-(1 fi 3)-glucan synthesis by Streptococcus sobrinus glucosyltransferase I pdf

... domain; GS, glucan-binding domain-deficient glucosyltransferase-I; GSd, glucansucrasedomain; GSGB, glucosyltransferase-I containing a full-length glucan-binding domain; GTF, glucosyltransferase.FEBS ... Methyl a- d-glucopyranoside was used as a glucose analog that is not a substrate of hexokinase in a glucose assay system. The data were analyzed on thebasis of the Michaelis–Menten equation; the maximumactivity ... method for determination of sugars and related substances. Anal Chem 28, 350–356.32 Chaplin MF (1986) Monosaccharides. In CarbohydrateAnalysis: Practical Approach (Chaplin MF & KennedyJF...
  • 10
  • 661
  • 0
Tài liệu Báo cáo khoa học: Exposure of IgG to an acidic environment results in molecular modifications and in enhanced protective activity in sepsis doc

Tài liệu Báo cáo khoa học: Exposure of IgG to an acidic environment results in molecular modifications and in enhanced protective activity in sepsis doc

... monoclonal Z2antibody in the presence of increasing concentrations of potassium thiocyanate (ranging from 0 to 2.0 m). Afterincubation and washing, the antibody binding was mea-sured using a goat ... dashed line. (E) Binding of twocommercially available IVIg preparations [Endobulin (solid line); Octagam (dashed line)] to human factor H. Data represent mean absorbancevalues ± standard deviation ... humanmacrophages by in uenza A (H5N1) viruses: a mechanism for the unusual severity of human disease?Lancet 360, 1831–1837.29 Ignatyev G, Steinkasserer A, Streltsova M, Atrasheus-kaya A, Agafonov...
  • 12
  • 620
  • 0
Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

... withendocytosis of intact ETA, in vivo association of the catalytic ETA -A sub-unit and low molecular mass ETA -A fragments was observed in theendosomal apparatus. After an in vitro proteolytic assay with an ... occurring mainly within domain III of ETA -A. Cell-free endosomes preloaded in vivo with ETA intraluminallyprocessed and extraluminally released intact ETA and ETA -A in vitro in a pH-dependent and ATP-dependent ... (h)AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDNALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGNQLSHMSPIYTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQTQPRREKRWSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRLHFPEGGSLAALTAHQACHLPLETFTRHRQPR2791ETA-B280GWEQLEQCGYPVQRLVALYLAARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVVSLTCPVAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWPETA -A LAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPPREDLK613 A BFig....
  • 15
  • 588
  • 0
Tài liệu Báo cáo khoa học: Properties of ecdysteroid receptors from diverse insect species in a heterologous cell culture system – a basis for screening novel insecticidal candidates docx

Tài liệu Báo cáo khoa học: Properties of ecdysteroid receptors from diverse insect species in a heterologous cell culture system – a basis for screening novel insecticidal candidates docx

... dibenzoylhydrazines onlarvicidal activity against the Colorado potato beetleLeptinotarsa decemlineata. Pest Manag Sci 57, 858–865.36 Nakagawa Y, Minakuchi C, Takahashi K & Ueno T(2002) Inhibition of [3H] ... S1. Amino acid alignment of linker region andligand-binding domain (LBD) of ecdysone receptors.Fig. S2. Amino acid alignment of linker region andligand-binding domain (LBD) of ultraspiracle ... showing bothinductive and potentiative activity.ResultsThe DNA-binding domains (DBDs) of Leptinotarsaand Drosophila EcR and USP are identical at everyamino acid position that is conserved among...
  • 12
  • 627
  • 0
Tài liệu Báo cáo khoa học: Implication of the glutamine synthetase ⁄glutamate synthase pathway in conditioning the amino acid metabolism in bundle sheath and mesophyll cells of maize leaves doc

Tài liệu Báo cáo khoa học: Implication of the glutamine synthetase ⁄glutamate synthase pathway in conditioning the amino acid metabolism in bundle sheath and mesophyll cells of maize leaves doc

... -FNR 1 (AB035644):forward primer, 5¢-ACAACACAAAATGTCAGCTGCAAAA-3¢; reverse primer, 5¢-AAGGCCAAGAAGGAGTCCAAGAAG-3¢; L-FNR 2 (AB035645): forward primer,5¢-TTGCTTGAGCTGAACAATACAATGAA-3¢; reverseprimer, ... from xylem, and viceversa. Glx (glutamine and glutamate: five carbonamide and amino acid) and Asx (asparagine andaspartate: four carbon amide and amino acid) werefound to be the main nitrogen ... primer, 5¢-TGTAATTCGACTCACTATAGGGTACGCAGCCACCAGTCATGTA-3¢; AS:sense probe: forward primer, 5¢-TGTAATTCGACTCACTATAGGGCCTCCCTGCTAGCTTCTACCG-3¢; reverseprimer, 5¢-TCCAGACATACAGACACGGGC-3¢; antisenseprobe:...
  • 14
  • 566
  • 0
Tài liệu Báo cáo khoa học: Inhibition of cobalamin-dependent methionine synthase by substituted benzo-fused heterocycles pptx

Tài liệu Báo cáo khoa học: Inhibition of cobalamin-dependent methionine synthase by substituted benzo-fused heterocycles pptx

... consisting of four functional domains arranged in a linear manner. Each one of these domains binds a different substrate or cofactor. In detail, the N-terminalmodule is the homocysteine (Hcy)-binding ... Protein Assay kitbased on the method of Bradford [44]. Standards and sam-ples were assayed in triplicate, according to the manufac-turer’s instructions. Sample absorbances were read against a ... tetrahydrofolate – participate in the activemethionine and folate pathways. Impaired methionine synthase activity hasbeen implicated in the pathogenesis of anaemias, cancer and neurologicaldisorders. Although...
  • 13
  • 424
  • 0
Tài liệu Báo cáo khoa học: Role of transcription factor activator protein 1 (AP1) in epidermal growth factor-mediated protection against apoptosis induced by a DNA-damaging agent doc

Tài liệu Báo cáo khoa học: Role of transcription factor activator protein 1 (AP1) in epidermal growth factor-mediated protection against apoptosis induced by a DNA-damaging agent doc

... Bcl-XLexpression, and the resistance against ADR-induced apop-tosis, suggesting that EGF transmitted the antiapoptotic signal in such a way that it activated AP1 via a MAP kinase signaling pathway. TMK-1cells ... signals against ADR-inducedapoptosis by causing activation of the phosphatidylinositol-3¢ -OH kinase(PtdIns3-K) ⁄ Akt signaling pathway in human epithelial cell line MKN74[Takeuchi K & ... 6A) . Because TAM67 lacks thetransactivation domain of c-Jun (amino acids 1–122),but retains the DNA binding and leucine-zipper region of c-Jun, it should function as a dominant-negativemutant...
  • 13
  • 493
  • 0

Xem thêm

Từ khóa: tài liệu báo cáo khoa học bản chất của khủng hoảng kinh tế thế giới pdftài liệu báo cáo nghiên cứu khoa họctài liệu về báo cáo khoa họcbáo cáo khoa học công nghệ phục vụ nông nghiệp và phát triển nông thôn các tỉnh phía bắc 2006 2007 tài liệu phục vụ hội nghịbáo cáo khoa học tài chính côngbáo cáo khoa học số loài quý hiếm tại vườn quốc gia ba bểtai lieu bao cao thuc tap khoa co khitai lieu bao cao thuc tap tai khoa duoc benh vientai lieu bao cao thuc tap y si da khoabáo cáo khoa học ảnh hưởng của tuổi thu hoạch đến năng suất và chất lượng thức ăn của cỏ voi pennisetum purpureum cỏ ghi nê panicum maximum trồng tại đan phượng hà tây pptxtai lieu bao cao thuc tap tim hieu nhan cach mot hoc sinhbáo cáo khoa học về nghệ thuật trong lieu trai chi ditai lieu bao cao thuc tap tai khoa duoc benh vien hop lucđề tài báo cáo khoa họcđề tài báo cáo khoa học sinh họcchuyên đề điện xoay chiều theo dạngNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitQuản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninhTrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Nghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Thơ nôm tứ tuyệt trào phúng hồ xuân hươngThiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khíTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)chuong 1 tong quan quan tri rui roGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀMMÔN TRUYỀN THÔNG MARKETING TÍCH HỢP