Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx

... 1 was shown to be critical for the bio-genesis of microRNAs and Arabidopsis development[24,25]. Arabidopsis TEBICHI, containing an N-termi-nal DELH box RNA helicase domain and a C-terminalDNA ... Journal 278 (2011) 2296–2306 ª 2011 The Authors Journal compilation ª 2011 FEBS A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana Rui-Rui ... [21–23], whether DExH box RNA helicases are involved in plant responses to abioticstresses remain to be addressed. In this study, we identiﬁed and characterized an Ara-bidopsis DEVH box RNA helicase...

Tài liệu Báo cáo khoa học: a-enolase: a promising therapeutic and diagnostic tumor target ppt

... Sahara H, Miyazaki A, Nabeta Y, Hiroh-ashi Y, Kanaseki T, Yamaguchi A, Yamada N, Hiray-ama K, Suzuki M et al. (2002) Natural antigenicpeptides from squamous cell carcinoma recognized byautologous ... Lopez-Fernandez LA, Harshman K, Martinez AC, Ortiz AR,Thomson TM & Paciucci R (2007) Activation of theepidermal growth factor signalling pathway by tissueplasminogen activator in pancreas cancer ... in both leu-kemia and lung cancer and one serine in both tumoral and normal pancreas.ENOA in tumor cells is subjected to more acetyla-tion, methylation and phoshorylation than in normaltissues,...

Tài liệu Báo cáo khoa học: A systems biology approach for the analysis of carbohydrate dynamics during acclimation to low temperature in Arabidopsis thaliana doc

... 2010 The Authors Journal compilation ª 2010 FEBS A systems biology approach for the analysis ofcarbohydrate dynamics during acclimation to lowtemperature in Arabidopsis thaliana Thomas Na¨gele, ... Hincha DK & Heyer AG (2004) Heterosis in the freezing tolerance of crosses between two Arabidop-sis thaliana accessions (Columbia-0 and C24) that showdifferences in non-acclimated and acclimated ... consumingsink organs or metabolic pathways other than carbo-hydrate pathways was calculated as the differencebetween net carbon uptake and changes in cellular car-bohydrate content. The resulting...

Tài liệu Báo cáo khoa học: A strategy for discovery of cancer glyco-biomarkers in serum using newly developed technologies for glycoproteomics ppt

... 4725–4733.22 Kagebayashi C, Yamaguchi I, Akinaga A, Kitano H, Yokoyama K, Satomura M, Kurosawa T, WatanabeM, Kawabata T, Chang W et al. (2009) Automatedimmunoassay system for AFP-L3% using on-chipelectrokinetic ... T, Yamauchi Y, Nakayama H, Shinkawa T,Yanagida M, Takahashi N & Isobe T (2002) A directnanoﬂow liquid chromatography–tandem massspectrometry system for interaction proteomics. AnalChem ... appearing in the dark gray area ofthe Venn diagram are thought to be relatively abundant in serum, and are primary candidates for further validation. Glycoproteinsfound in the pale gray area are...

Tài liệu Báo cáo khoa học: The plasminogen activator inhibitor 2 transcript is destabilized via a multi-component 3¢ UTR localized adenylate and uridylate-rich instability element in an analogous manner to cytokines and oncogenes pdf

... Forward (nt 1552–1585 PAI-2)SJS260 AACTCACCATAGGAATGCATAATAAATAACAAAG Reverse (nt 1585–1552 PAI-2)SJS261 CTTTGTTAAAGCTTATGCATTCCTATGGTGAGTT Forward (nt 1552–1585 PAI-2)SJS262 AACTCACCATAGGAATGCATAAGCTTTAACAAAG ... promoter and total RNA was harvested in Trizol at the indicated times.Total RNA (7.5 lg) from each sample was analysed byRNase protection assay or by northern analysis (10 lgoftotal RNA) using the ... the intron spanning32P-labelled globin and GAPDH probes described above. The b-globin and GAPDH mRNA band intensities were visualized and quantiﬁed with a Phosphorimager Storm (MolecularDynamics)....

Tài liệu Báo cáo khoa học: a-Defensins increase lung ﬁbroblast proliferation and collagen synthesis via the b-catenin signaling pathway doc

... changes in total b-catenin, suggesting that a- defensins activate theb-catenin signaling pathway. We then studied the roleof the b-catenin signaling pathway in a- defensin-induced increases in ... Hiratsuka T, Mukae H, Iiboshi H, Ashitani J,Nabeshima K, Minematsu T, Chino N, Ihi T, Kohno S& Nakazato M (2003) Increased concentrations ofhuman beta-defensins in plasma and bronchoalveolarFibroblast ... found that a- defensin-1 and a- defensin-2 induced increases in the phosphorylationof GSK3b and b-catenin activation and that inhibitionof b -catenin activation prevented a- defensin-inducedproliferation...

Tài liệu Báo cáo khoa học: A role of miR-27 in the regulation of adipogenesis ppt

... control was maintained in a standard incubator with 21% O2. The normoxia data are the same as shown in Fig. 1 and are included here for comparison. Expression of miR-2 7a and miR-27b at the indicated ... Hosogai N, Fukuhara A, Oshima K, Miyata Y, TanakaS, Segawa K, Furukawa S, Tochino Y, Komuro R,Matsuda M et al. (2007) Adipose tissue hypoxia in obesity and its impact on adipocytokine dysregulation.Diabetes ... miR-2 7a and miR-27b, although located, respectively, in chro-mosomes 8 and 13, are coordinately increased in obesetissue. In contrast, miR-17-5p, miR-2 0a and miR-92,miRNAs that are located in the...

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... b-cryptoxanthin [10]. Thezeaxanthin produced by CYP17 5A1 is used as an inter-mediate for the synthesis of thermozeaxanthins and thermobiszeaxanthins, which are the main carotenoidsof T. thermophilus ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... well as NADPH,the Kmvalue of the FNR for NADPH was about600-fold lower than that for NADH, and the Vmaxvalueof the FNR with NADPH was about 55-fold higher A 6247.532.52516.5kDa12...

Tài liệu Báo cáo khoa học: A facile method for expression and puriﬁcation of the Alzheimer’s disease-associated amyloid b-peptide pdf

... 5¢-ATGGACGCTGAATTCCGTCACGACTCTGGTTACGAAGTTCACCACCAGAAGCTGGTG-3¢;Abb, 5¢-GTTCACCACCAGAAGCTGGTGTTCTTC GCTGAA GACGT GGGTTCT AACAAGGGTGCT-3¢;Abc, 5¢-CACAACGCCACCAACCATCAGACCGATGATAGCACCCTTGTTAGAACCCAC-3¢;Ab-start, 5¢-GCGTAGGGTCGACATATGGACGCTGAATTCCGTCACG-3¢;Abstop, ... 5¢-GCGTAGGGTCGACATATGGACGCTGAATTCCGTCACG-3¢;Abstop, 5¢-CCTGCCGAGCTCCTATTACACAACGCCACCAACCATCAG-3¢.The PCR solution was prepared in the buffer suppliedwith the enzyme, and contained Aba, Abb and Abcat40 nm each, and the start and ... decreasedclearance causes an accumulation of Ab and that thistriggers a pathogenic cascade culminating in the cog-nitive deﬁcits that characterize Alzheimer’s disease[13–16]. The self-association...

Tài liệu Báo cáo khoa học: Identiﬁcation of two late acyltransferase genes responsible for lipid A biosynthesis in Moraxella catarrhalis doc

... onthe pulmonary clearance assay, R. Morell for helpwith DNA sequencing, Yandan Yang for help withSouthern blotting, and Lina Zhu and Yili Chen for help in manuscript preparation. This research ... as Neisseria meningitidis and H. in uenzae [13–15]. Studies have also suggested thatM. catarrhalis LOS is important in the pathogenesis ofM. catarrhalis infection [16–19]. In contrast to theLOS ... TGG CAA CTC (atr antisense) This studyasd1 AAG CCG ATG ACA CCA ATT (asd sense) This studyasd2 GCA GGT TCA TAG TGC ATG (asd antisense) This studyKan RP GGT GCG ACA ATC TAT CGA (kanamycin sense)...

Xem thêm

Từ khóa: tài liệu báo cáo nghiên cứu khoa học tài liệu về báo cáo khoa học báo cáo khoa học tài chính công báo cáo khoa học số loài quý hiếm tại vườn quốc gia ba bể tai lieu bao cao thuc tap khoa co khi tai lieu bao cao thuc tap tai khoa duoc benh vien Báo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018 chuyên đề điện xoay chiều theo dạng Một số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTP Nghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THz Nghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt nam Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Quản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninh Phối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọ Phát hiện xâm nhập dựa trên thuật toán k means Nghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùng Nghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúng Chuong 2 nhận dạng rui ro Tổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Trách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘI