write the standard form of the equation y 4 127x1
Tài liệu Supply the correct form of the verbs1 docx
Ngày tải lên :
23/01/2014, 07:20
... snake.
14. My brother managed to kill the snake just at the time when I were almost exhausted.
Supply the correct form of the verbs
1. Cats could fly if they (have) wings.
2. If Peter (study) harder, ... Cats could fly if they (have) had wings.
2. If Peter (study) studied harder, he would get better marks.
3. You will be late for class if you (not, hurry) don't hurry
4. Mary would not have ... better marks.
3. You will be late for class if you (not, hurry).
4. Mary would not have got wet if she (wear) a raincoat.
5. If today (be) a holiday, I would stay in bed for all day long.
6. If...
- 5
- 1K
- 3
Báo cáo khoa học: The propeptide in the precursor form of carboxypeptidase Y ensures cooperative unfolding and the carbohydrate moiety exerts a protective effect against heat and pressure pot
Ngày tải lên :
07/03/2014, 21:20
... effectively digested by intracellular proteases.
Contributions of the carbohydrate moiety
The specific activities of glycosylated and unglycosylated
CPY are the same as previously reported [13] with the ... higher by 4 °Cthan
that of Dgly proCPY, indicating that the carbohydrate
moiety exerts a slightly protective effect on the thermal
unfolding of proCPY.
The P
m
value for CPY was higher than that of ... its
unglycosylated form, though the DV and DG
P
values were
almost the same. The P
m
value of proCPY was higher than
that of its unglycosylated form. This is due to the higher DV
value of the unglycosylated...
- 7
- 439
- 0
Báo cáo y học: "Study of the early steps of the Hepatitis B Virus life cycle"
Ngày tải lên :
03/11/2012, 10:09
... confirmed the role of LHBs in the HBV attachment [23]. Recently, the
attachment site of LHBs was functionally narrowed down to the amino acids 21 47 of preS1 by
employing synthetic peptides. The ... translocation of the internally sequence of
PreS1 domain onto the viral surface [62, 63]. This supports the hypothesis that the low pH in the
endosome may induce the conformation change of HBV surface ... by the
observation of the conformation change of the large surface protein of DHBV at low pH condition [62].
However, the more detail investigation was from the kinetic study of the uptake of...
- 13
- 654
- 1
Báo cáo y học: Esterified Hyaluronic Acid and Autologous Bone in the Surgical Correction of the Infra-Bone Defects"
Ngày tải lên :
03/11/2012, 11:35
... - 2,9 6 ,4 - 6,8 4, 3 - 2,6
2 40 M 50 50 Defect at 3 walls 35 - 36 7,5 - 5,0 4, 3 - 3,8 6 - 6 ,4 3,3 - 1,3
3 40 M 50 50 Defect at 3 walls 44 - 45 7,5 - 5,0 4, 3 - 3,1 4 - 4, 3 3,3 - 1,9
4 28 M 60 ... ophthalmology, dermatology, dentistry and
rheumatology [10,11].
Based up on these data the aim of this study was
to observe the potential of Esterified
Hyaluronic Acid
(EHA) as a coadjuvant of grafting ...
Department of Dental Sciences and Surgery, University of Bari, Bari, Italy.
Correspondence to: Prof. F.R. GRASSI, Professor and Dean, Department of Dental Sciences and Surgery - University of
Bari,...
- 7
- 769
- 0
Tài liệu Báo cáo khoa học: The pro-form of BMP-2 interferes with BMP-2 signalling by competing with BMP-2 for IA receptor binding pptx
Ngày tải lên :
18/02/2014, 06:20
... FEBS
non-covalent complex of the pro-peptide and BMP-9
can bind to the type I receptor Alk1 [17], the latency-
associated polypeptide of TGFb inhibits the interac-
tion of TGFb isoforms with type II and III ... phosphorylation. The data presented here suggest that the
pro-domain of BMP-2 can alter the signalling properties of the growth factor
by modulating the ability of the mature part to interact with the ... transforming
growth factor b (TGFb) ⁄ BLP superfamily. The role of the 263 amino acids
of the pro-peptide is currently unclear. In order to obtain an insight into the
function of the pro-form...
- 13
- 892
- 0
Tài liệu Báo cáo khoa học: Regulation of dCTP deaminase from Escherichia coli by nonallosteric dTTP binding to an inactive form of the enzyme ppt
Ngày tải lên :
18/02/2014, 16:20
... rearranged in
the dTTP complex to accommodate the 5-methyl
group of the thymine moiety. As a result, the Ala1 24
carbonyl was moved from the 4- oxo ⁄ 4- amino group of
the bound nucleotide and the side ... Denmark
Synthesis of dTMP by thymidylate synthase proceeds
by the reductive methylation of dUMP, which is
obtained via one of two parallel pathways. One path-
way, considered to be a minor supplier of ... after the transition of the enzyme to a
more active form, respectively, t is the time and s is the lag-
time. The rate constant, k, for the activation of the enzyme is
obtained as 1 ⁄ s.
Crystallization
Crystals...
- 11
- 577
- 0
Tài liệu Báo cáo khoa học: Expression and function of Noxo1c, an alternative splicing form of the NADPH oxidase organizer 1 doc
Ngày tải lên :
19/02/2014, 06:20
... whether each tran-
script possesses the activity to support activation of
the Nox enzymes. In this study, we show the expres-
sion of alternatively spliced transcripts of the NOXO1
gene, by PCR ... 2C, the mRNA for
Noxo1c was expressed substantially in the testis but
only slightly in the colon. On the other hand, the
Noxo1b mRNA was relatively abundant in the colon
and also present in the ... by
gp91
phox
leads to subsequent formation of microbicidal
reactive oxygen species such as hydroxyl radical and
hypochlorous acid. Nox1, the second member of the
Nox family, is abundant in the...
- 15
- 632
- 0
Tài liệu Báo cáo Y học: Soluble silk-like organic matrix in the nacreous layer of the bivalve Pinctada maxima A new insight in the biomineralization field pptx
Ngày tải lên :
21/02/2014, 01:21
... for the first time the results of a
comparative study on the organic matrix extracted from
the nacreous layer of the shell from the pearl oyster
Pinctada maxima by two very different methods. The ... 7 54.
46 .Marxen,J.C.,Hammer,M.,Gehrke,T.&Becker,W.(1998)
Carbohydrates of the organic shell matrix and the shell forming
tissue of the snail Biomphalaria glabrata (Say). Biol. Bull. 1 94,
231– 240 .
47 . Miyazawa, T. & Blout, E.R. (1961) The infrared ... a
Waters 42 0 fluorimeter. Proline, hydroxyproline and
hydroxylysine were examined at 2 54 nm by reverse-phase
HPLC of their phenylisothiocarbamate derivatives [26], as
reported previously [20]. The...
- 10
- 731
- 0
Tài liệu Báo cáo Y học: Interallelic complementation provides genetic evidence for the multimeric organization of the Phycomyces blakesleeanus phytoene dehydrogenase doc
Ngày tải lên :
22/02/2014, 04:20
... [ 54] .
As th e activity of this mutant enzyme could not be restored
by the addition of Tween 40 [39], i t can be concluded that
the 48 2 Gly residue is important for the activity of the
enzyme, ... via three enzymatic steps carried out by the
enzymes phytoene synthase, phytoene dehydrogenase and
lycopene cyclase. The enzyme phytoene dehydrogenase is
able to introduce four dehydrogenations ... while the
catalytic activity of the phytoene dehydrogenase in strain
S 442 is directly affected by the mutation, strain C5 possesses
a f unctional enzyme, likely altered in a region relevant for
the...
- 7
- 479
- 0
Báo cáo khoa học: Crystal structures of the apo form of b-fructofuranosidase from Bifidobacterium longum and its complex with fructose pot
Ngày tải lên :
06/03/2014, 00:21
... L
4 –5¢
(Gln4 34- Arg 441 ).
These two loops interact with the tips of four other
loops: L
1–1¢
(Gly378-Asp375), L
2¢–2
(Ala402-Arg4 04) ,
L
3¢ 4
(Gly4 24- Gly427) and L
6–6¢
(Glu498-Gly500). The
buried surface area of the ... KGKYHMFYQYNPRKPEWG-NICWGHA
1Y4 W FNYDQ-PYRGQYHFSPQKNWMNDPNGLLYH NGTYHLFFQYNPGGIEWG-NISWGHA
3KF5 SIDLSVDTSEYNRPLIHFTPEKGWMNDPNGLFYDKTAKLWHLYFQYNPNATAWGQPLYWGHA
2AC1 NQ-PYRTGFHFQPPKNWMNDPNGPMIY KGIYHLFYQWNPKGAVWG-NIVWAHS
2ADE ... states
(Fig. 4) . In the first step of the enzymatic reaction, a
nucleophilic attack is performed on the anomeric car-
bon of the sugar substrate by the carboxylate of the
Asp 54 acting as the primary nucleophile,...
- 17
- 521
- 0
Báo cáo khoa học: DNA polymerase e associates with the elongating form of RNA polymerase II and nascent transcripts pot
Ngày tải lên :
07/03/2014, 11:20
... by carrying out the labelling procedure without
primary antibody. The efficiency of blocking was controlled
by performing the labelling procedure in the absence of the
second primary antibody. ... University of Joensuu, Finland
3 Biocenter Oulu and Department of Pathology, University of Oulu, Finland
4 National University of Ireland, Department of Biochemistry, Cell Cycle Control Laboratory, ... hyperphosphorylated
elongating isoform RNA pol IIO
RNA pol II exists in a dynamic equilibrium between
the hypophosphorylated initiation isoform IIA and
the hyperphosphorylated elongating isoform IIO that
exhibits...
- 15
- 584
- 0
Báo cáo khoa học: Purification and structural study of the b form of human cAMP-dependent protein kinase inhibitor pdf
Ngày tải lên :
07/03/2014, 15:20
... [15].
Assay of human PKIb activity
The activity of purified human PKIb was assayed by the
inhibition of the catalytic subunit of cAPK in a 50 lL
reaction containing 0.5 units of purified catalytic subunit,
25 ... acetate buffer. The pooled
fraction was stored at )20 °C for further study. The
concentration of the proteins was determined by the
method of Lowry et al. [ 14] and the purity was examined
by SDS/PAGE ... showedasinglebandbySDS/PAGE
(Fig. 2). The assay of its activity demonstrated that the
purified PKIb inhibited the catalytic subunit of cAPK with
the specific activity of 6.0 · 10
4
unitÆmg
)1
(Fig. 3A) .The K
i
value...
- 6
- 531
- 0
Báo cáo khoa học: Isothermal unfolding studies on the apo and holo forms of Plasmodium falciparum acyl carrier protein Role of the 4¢-phosphopantetheine group in the stability of the holo form of Plasmodium falciparum acyl carrier protein docx
Ngày tải lên :
16/03/2014, 10:20
... fatty acid elongation,
in contrast to the multifunctional enzyme catalyzing all
the steps of the type I FAS pathway [4, 5]. ACP is an
essential component of both type I and type II fatty
acid synthesis ... apparent from the solution denaturation studies
that the holo form of the protein has greater stability
than the apo form. The differences in the unfolding
thermodynamic parameters of the two forms are ... done. The higher stabil-
ity of the holo form can be attributed to the number of favorable contacts
that the 4 -phosphopantetheine group makes with the surface residues by
virtue of a number of hydrogen...
- 14
- 419
- 0
Báo cáo Y học: S-Decyl-glutathione nonspecifically stimulates the ATPase activity of the nucleotide-binding domains of the human multidrug resistance-associated protein, MRP1 (ABCC1) ppt
Ngày tải lên :
17/03/2014, 23:20
... m
M
of S-decyl-glutathione, the meas-
ured ATPase activity represented approximately the basal
ATPase activity. This type of behaviour was also observed
for the stimulatory effect of S-decyl-glutathione ... concentrations were determined
by the Bradford assay using BSA as the standard.
The following purified proteins were kindly provided by
colleagues: the MBP fusion protein of the NBD of the
lactococcal half-transporter ... from the thermoacido-
philic Sulfolobus solfataricus, by S. Albers (Groningen
University, the Netherlands).
ATPase activity
The ATPase activity of NBDs was measured by a colori-
metric assay [ 34] ....
- 9
- 564
- 0
- the standard form of the equation
- write the standard form of the equation calculator
- identify the standard form of the equation 13x 73y 2
- determine the standard form of the equation
- finding the standard form of the equation for a conic section
- write the standard form of the equation
- the standard form of the equation of a line
- the standard form of the equation of a parabola
- the standard form of the equation of a circle is
Tìm thêm:
- hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam
- xác định các mục tiêu của chương trình
- xác định các nguyên tắc biên soạn
- khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn
- khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản
- khảo sát chương trình đào tạo gắn với các giáo trình cụ thể
- xác định thời lượng học về mặt lí thuyết và thực tế
- tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam
- điều tra đối với đối tượng giảng viên và đối tượng quản lí
- điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1
- khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam
- khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu
- nội dung cụ thể cho từng kĩ năng ở từng cấp độ
- xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct
- phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ
- mở máy động cơ lồng sóc
- mở máy động cơ rôto dây quấn
- các đặc tính của động cơ điện không đồng bộ
- hệ số công suất cosp fi p2
- đặc tuyến hiệu suất h fi p2