... proteases of the coagulation system including thrombin (factorIIa) and factors IXa, Xa, XIa and XIIa. The princi-pal targets of the serpin are usually regarded as beingthrombin and factor Xa, although ... immediate and medium term future.AcknowledgementsThis work was supported bythe National Health &Medical Research Council of Australia, the Austra-lian Research Council, the National Heart ... bond cleavage appears to be arrested at the acyl intermediate bythe unique action of the serpin,whereby the RCL of the serpin inserts into the major A b -sheet causing the protease to be rapidly...
... lit by candles anddraped with gathered curtains that turned the walls into the proscenia of a grand and ancient stage. There were four or five small tables and a long one at the back of the ... either," said a voice at his side. I used to changefor the F Train there every day when I was a kid." It was a woman, about the same age as Gerta, but more beaten down bythe years, ... the neat stitching that ran the bind-ing and the spine, holding together the nylon and the denim, taken from a pair of jeans, a backpack. The end-papers were yellowed page threegirls from the...
... (1979) Aminoacids in the Yamato carbonaceous chondrite from Antarc-tica. Nature 282, 1183–1186.Shimoyama, A. , Harada, K. and Yanai, K. (1985) Amino acids from the Yamato-791198 carbonaceous ... study, the abun-dance of Gly, L,D-Ala, AIB, and L,D-isovaline (Isoval)is examined, because Gly and Ala are abundant aminoacids in most extraterrestrial materials, and AIB and Isovalare free ... from Itokawa 69Fig. 6. Mass spectra of negative ions in ToF-SIMS analysis. a) Hayabusa particles extract, and b) blank extract. 64 H. Naraoka et al.material analyses (Fig. 1). The -0017 particle...
... the NN – they had another better help before the NN contacted them. The NN took the primary contact to the femalepatients and offered help in the early part of a cancertrajectory. The NN was ... what kind of add-itional helpthe patients should have. Navigators incancer care have been proposed to embrace this extra help. They helpthe cancer patient “not only travel the healthcare maze ... I have heardnothing. I find that scary. (At discharge)Doctors . come and go as they see fit . they comeand say their bit and then they leave again (ye s)they can go as far as to turn their...
... oxidase from Paracoccusdenitrificans. Nature 376, 660–669.8. Tsukihara, T., Aoyama, H., Yamashita, E., Tomizaki, T., Yamaguchi, H., Shinzawa-Itoh, K., Nakashima, R., Yaono, R. &Yoshikawa, ... sealed with another CaF2plate, and placed into a metallic sample holder. The following cuvette handlingwas carried out in the aerobic atmosphere. The absorbancespectra of the mixture before and ... sample containment, maintained at 4 °C, was purged with dry air to minimize absorbance by water vapor. A water-cooled globar was used as source of radiation, whichwas measured bya nitrogen-cooled...
... 489–495.4 Kinoshita S, Terada T, Taniguchi T, Takene Y, Masu-da S, Matsunaga N & Okada H (1981) Purification andcharacterization of 6-aminohexanoic acid oligomerhydrolase of Flavobacterium sp. ... S& Higuchi Y (2005) Crystallization and x-ray diffrac-tion analysis of 6-aminohexanoate-dimer hydrolase from Arthrobacter sp. KI72. Acta CrystallogrF61,928–930.15 Hatanaka HS, Fujiyama ... potentially possesses an advantage for biotechnological applications.X-ray crystallographic analyses of the G181D ⁄ H266N ⁄ D370Y enzyme and the inactive S11 2A- mutant–Ald complex revealed that Ald...
... CAGGCTCGTGGTGCTAAATGCCCGAACTGCCTGTGCTGTG3f GTAAGTACGGCTTCTGCGGTTCTGGTGACGCTTACTGTGG4f CGCTGGTTCTTGCCAGTCTCAGTGCCGTGGTTGCTAGGGAT1r TTTAGCACCACGAGCCTGGTCACCGCAACGCTGAGC2r CGCAGAAGCCGTACTTACCACAGCACAGGCAGTTCG3r ... CGCAGAAGCCGTACTTACCACAGCACAGGCAGTTCG3r GACTGGCAAGAACCAGCGCCACAGTAAGCGTCACCAReverse GCTAGGATCCCTAGCAACCACGGCACTable 2. Antifungal activity of WAMP- 1a. IC50is the concentrationnecessary for 50% growth inhibition.Fungi ... Escherichia coli and assays of recombinant WAMP- 1a activity against diverse plant pathogens, such aschitin-containing and chitin-free fungi, and Gram-positive and Gram-negative bacteria. The amino acidsequence...
... survival) after irradiation. The in vivobiological activity was assayed bythe ability to prevent UVinduced erythema of human skin. After informed consentand approval fromthe Ethical Committee ... DNA lesions depends on the capacity of the cell to repair the damage before it can be incorporatedpermanently into the genome. Typically, DNA damage isrepaired at a relative high rate in human ... cyanobacteria,corals and other marine organisms are much moreadvanced than those of mammals because photosyntheticorganisms depend on solar irradiation as their primarysource of energy, and at the same time...
... collec-tion and refinement are summarized in Table 1. The program procheck [34] was used to analyse conforma-tional variations fromthe defined norms, with the quality of the Ramachandran plots [35] ... to the fact that in the latter the absence of coordination bythe Met does notimpose any conformational constraints and the locali-zed region of the loop affected by release of the Metligand ... To accommodateK100 as a ligand a number of main-chain atoms aredisplaced relative to their positions in the wt structure.Although backbone deviations are detected at the startof the ligand...
... andanalysed by SDS/PAGE.Carboxypeptidase assays and expressionof HaCA42 mRNACarboxypeptidase assays using the synthetic substratesfurylacryloyl-Phe-Phe (FAPP), furylacryloyl-Ala-Lys(FAAK) ... enzyme wasanalysed by SDS/PAGE (data not shown). By analogy with the activation of mammalian carboxypeptidases, thesepolypeptides correspond to the active HaCa42 carboxy-peptidase (36 kDa polypeptide) ... in the databases. The two proteins migratingat 50 and 55 kDa (bands A and B; Fig. 1A) wereidentified from their N-terminal sequences as similar to a- amylase (accession no. AAA17751) from...
... of all the b Na-ScTxs from all the a Na-ScTxs. Thea Na-ScTxs have identities of the orderof 50% among themselves, the same being true for all the b Na-ScTxs (data not shown). However, when the ... constraints wereadded to the calculations. The dynamic annealing struc-ture calculations were performed withthe CNS softwaresuite [44].Analysis of Na+-channel sequences By searching data banks ... 7.30.Patch-clamp recordings and data analysis. The currentswere recorded by means of the patch-clamp amplifierMultiClamp 70 0A (Axon Instruments, Foster City, CA,USA) at room temperature as previously...
... GWMSKIASGIGTFLSGMQQaDRS B1 AMWKDVLKKIGTVALHAGKAALGAVADTISQaDRS B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAVaDRS B3 ALWKNMLKGIGKLAGQAALGAVKTLVGAEDRS B4 ALWKDILKNVGKAAGKAVLNTVTDMVNQaDRS B6 ALWKDILKNAGKAALNEINQLVNQaPBN2 ... 5Â-AGCATAACTGGAACGTGGG-3Â forcaerin 1.12, 5Â-CAGCAATAAGTGGAACAACG-3Â forcaerin 1.13, 5Â-GTGTTTAGCAACGGATTTACC-3Âfor caerin 1.14 and 5Â-AGCAACGGATCCTAGGACAC-3Â for caerin 1.15. The temperature ... isolatedIndia between 150 and 65 Ma and colonized the Laurasian land massafter India collided with Asia. Abbreviations; AF, Africa; IND, India;AUS, Australia; SA, South America; ANT, Antartica....
... LUVs.Similar aggregates appeared only very faintly in the absenceof lipids (Fig. 4A) . The rather long lag phase preceding fasthemolysis (Fig. 1A) may also indicate that the formation of a functional ... initiation bythe mushroom Agrocybe aegerita [3,4].Moreover, 13 of the ESTs, if translated, are identical with a 138-amino-acid protein (PriA) translated from P. ostreatuscDNA (EMBL/GenBank/DDBJ databases: ... activity at nanomolarconcentrations. Searches in the nucleotide and proteindatabases revealed that the sequence of the ostreolysinN-terminal 50 amino acids was 88% identical with the putative PriA...
... and E101–206), the primers 5Â-GTTGCCATGGCTGTGAAATTGATGGGA-3Â (forward), 5Â-CTCCGAGCTCTCATGGCAGTTTAAC-3Â (reverse) and 5Â-ATACCATGGAACAGCCAGAGTATAAAG-3Â (forward), 5 Â-AGGGAGCTCTCAGAATAACTTCTCTGTA-3Â ... pos-sesses a water-soluble A 1domain, containing the cata-lytic sites, and an integral membrane A 0domain,involved in ion translocation [2–4]. The primary struc-ture of the archaeal ATP synthase ... association was obtained by titration studies using the N-terminal peptides E1–20, E21–40 andE41–60. These data indicate that the N-terminal tail E41–60 interacts with the N-terminal amino acids...