... heparan sulfateand dermatan sulfate GAGs are physiological activa-tors of HC-II, many different polyanions, includingpolyphosphates, polysulfates and polycarboxylates, areable to accelerate HC-II ... Austra-lian Research Council, the National Heart Founda-tion of Australia (to RNP and AMB), ResearchGrants HL-06350 and HL-32656 from the NationalInstitutes of Health (to FCC), the Institut Nationalde ... by der-matan sulfate. Ann N Y Acad Sci 556, 116–122.60 Maimone MM & Tollefsen DM (1990) Structure of a dermatan sulfate hexasaccharide that binds to heparincofactor II with high affinity....
... theytake you away and then later, they always find a reason to keep youaway."Lawrence's hackles were coming up. He found stuff that didn't belong inthe data — he didn't arrest ... doesn't really care about space travel. It used to, orat least when I was growing up all the science fiction I read promisedthat space travel would someday be commonplace. That was what madeit ... room lit by candles anddraped with gathered curtains that turned the walls into the proscenia of a grand and ancient stage. There were four or five small tables and a long one at the back of the...
... go back and try that approach with the original problem. Ask if the student can make an estimate of the answer. If the answer is a number, about how big is it? Bigger or smaller than 1? ... understand the mathematical concepts Lauren Richetti, an IMP 4 student, presents a graph How to HelpWith Math Homework When The Answers Aren’t in the Book How to HelpWith Homework As you may ... Blatner Pamphlet layout and design by Jeremiah Beaudry and William Blatner Photos by William Blatner and Jackie Rigali How to HelpWith Math Homework When The Answers Aren’t in the Book...
... Fremont A, Khan DC, Huang D, Knapp H, Karaman D, et al:Lay patient navigator program implementation for equal access tocancer care and clinical trials: essential steps and initial challenges.Cancer ... patients, a standard that could be metby using an NN to make need assessments, link appro-priate services to patients and make a subsequentfollow-up and evaluation. Their advice was that all can-cer ... instance bedone by a lay community peer, a medical assistant, a social worker or a cancer survivor with minor coursesin healthcare [5,12]. It can also be done by a nurse (a Nurse Navigator...
... oxidase from Paracoccusdenitrificans. Nature 376, 660–669.8. Tsukihara, T., Aoyama, H., Yamashita, E., Tomizaki, T., Yamaguchi, H., Shinzawa-Itoh, K., Nakashima, R., Yaono, R. &Yoshikawa, ... sample containment, maintained at 4 °C, was purged with dry air to minimize absorbance by water vapor. A water-cooled globar was used as source of radiation, whichwas measured by a nitrogen-cooled ... of about1 ms, which was evaluated without application of spectraldeconvolution analysis. Using the oxygenation of myoglo-bin as a different indicator, significant flash-inducedabsorbance changes...
... CAGGCTCGTGGTGCTAAATGCCCGAACTGCCTGTGCTGTG3f GTAAGTACGGCTTCTGCGGTTCTGGTGACGCTTACTGTGG4f CGCTGGTTCTTGCCAGTCTCAGTGCCGTGGTTGCTAGGGAT1r TTTAGCACCACGAGCCTGGTCACCGCAACGCTGAGC2r CGCAGAAGCCGTACTTACCACAGCACAGGCAGTTCG3r ... CGCAGAAGCCGTACTTACCACAGCACAGGCAGTTCG3r GACTGGCAAGAACCAGCGCCACAGTAAGCGTCACCAReverse GCTAGGATCCCTAGCAACCACGGCACTable 2. Antifungal activity of WAMP- 1a. IC50is the concentrationnecessary for 50% growth inhibition.Fungi ... kiharae seeds witha unique 10-cysteine motifTatyana I. Odintsova1, Alexander A. Vassilevski2, Anna A. Slavokhotova1,Alexander K. Musolyamov2, Ekaterina I. Finkina2, Natalia V. Khadeeva1,...
... M. & Dembitsky, V.M.(2003) Characterization of surface n-alkanes and fatty acids of theepiphytic lichen Xanthoria parietina, its photobiont a green algaTrebuxia sp. and its mycobiont, from ... whichpossess a common cyclohexenone ring system linked by anaminoacidoranamino-alcohol[11].Incontrast,MAAsareUV absorbing metabolites of algae that contain an amino-cyclohexenimine ring system, with ... ten photons from hittingcytoplasmic targets in cyanobacteria. Cells with highconcentrations of MAAs are approximately 25% moreresistant to UV radiation centered at 320 nm than those with no or...
... diffraction data of the wt and M100K crystalswere collected on an in-house beam using a MAR345Image Plate detector. The crystals were mounted in a capil-lary and datasets at 295 K and were measured ... single-exponential decay in the program Origin.AcknowledgementsJ .A. R.W. and A- M.M.R. are grateful to Dr N.S. Pan-nu for helpwith data processing and answers tonumerous questions. J .A. R.W. and G.W.C. are ... Katayama Y, Hiraishi A & Kuraishi H (1995) Para-coccus thiocyanatus a new species of thiocyanate utiliz-ing facultative chemolithotroph, and transfer ofThiobacillus versutus to the genus Paracoccus...
... which hadextra bases added to include PstI(N-terminal)andSalI(C-terminal) restriction sites: Forward, 5Â-CGCGCTGCAGGTCATGAGAAATATGAAGGA-3Â;Reverse,5Â-GCGCGTCGACTGAATAGTTTTGCAAGACGTACTG-3Â.They ... andanalysed by SDS/PAGE.Carboxypeptidase assays and expressionof HaCA42 mRNACarboxypeptidase assays using the synthetic substratesfurylacryloyl-Phe-Phe (FAPP), furylacryloyl-Ala-Lys(FAAK) ... serine protease (Y12274)B (50)YKNPYYAPGR(S)VNVN Bombyx moriALAY KNPHYAS GR T TMVHLFE a- amylase (AAA17751) A (55)YLNPXY Bombyx moriALAYKNPHYASGRTTMVHLFE a- amylase (AAA17751)6Mguanidine hydrochlorideE...
... 3 of Na+channels. A total of 50 nonredundant sequences ofNa+channels available in databases were aligned with CLUSTAL X[45]. The segments S5–S6 of domain I and S3–S4 of domain IV from selectedsequences ... are shown (NaV1.1, 1.4 and 1.5 from rat; NaV1.7 from human; Para from fruit fly; NachB1 from squid). Conserved residues are indicatedby asterisks, and conservative replacements by dots. Acidic ... bindsto neuronal preparations from cockroach witha 10 000-fold higher affinity than to rat brain synaptosomes [51]). Inaddition, some toxins are capable of discriminating betweenNa+-channel isoforms...
... GWMSKIASGIGTFLSGMQQaDRS B1 AMWKDVLKKIGTVALHAGKAALGAVADTISQaDRS B2 GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAVaDRS B3 ALWKNMLKGIGKLAGQAALGAVKTLVGAEDRS B4 ALWKDILKNVGKAAGKAVLNTVTDMVNQaDRS B6 ALWKDILKNAGKAALNEINQLVNQaPBN2 ... 5Â-GAAGTACGTGCTTAGCAACGG-3Â for caerin 1.15, and fornested PCR: 5Â-ATAACTGGAACAACGTGTGG-3Âfor caerin 1.1, 5Â-CTAAGTGCTCAGCAATGACG-3Âfor caerin 1.11, 5Â-AGCATAACTGGAACGTGGG-3Â forcaerin 1.12, 5Â-CAGCAATAAGTGGAACAACG-3Â ... SouthAmerica and probably reached Australia via the connection with Antartica and South America [66]. Evidence for thedispersal of land vertebrates from South America toAustralia via Antartica also...
... breast adenocarci-noma, were obtained from the Istituto ZooprofilatticoSperimentale della Lombardia e dell’Emilia, Brescia, Italy.Lipids. A series of natural and synthetic lipids andderivatives ... aerugi-nosa (TrEMBL db: Q9I710). It has been speculated thatAa-Pri1, and similar proteins, may have important roles inthe initial phase of fungal fruiting, such as hyphae aggre-gation [4], or in apoptosis ... the secondary structure ofostreolysin with and without lipids. Values are mean ± SD. b1, Anti-parallel b-sheet; b2, parallel and antiparallel b-sheet; t, b-turn; a, a- helix; r, random coil;...
... 5Â-GTTGCCATGGCTGTGAAATTGATGGGA-3Â (forward), 5Â-CTCCGAGCTCTCATGGCAGTTTAAC-3Â (reverse) and 5Â-ATACCATGGAACAGCCAGAGTATAAAG-3Â (forward), 5 Â-AGGGAGCTCTCAGAATAACTTCTCTGTA-3Â (reverse),respectively, ... the A- ATP synthase from Methanocaldococcus jannaschiiShovanlal Gayen, Asha M. Balakrishna, Goran Biukovic, Wu Yulei, Cornelia Hunke andGerhard GruăberSchool of Biological Sciences, Nanyang ... Ger-many). Atto488–maleimide was obtained from ATTO-TEC(Siegen, Germany). All other chemicals were at least ofanalytical grade and were purchased from BIOMOL (Ham-burg, Germany), Merck (Darmstadt,...
... Func-tionally, differentiation was accompanied by theexpression of aminopeptidase N, lactase, maltase andsucrase activities. Sucrase-isomaltase is localized at theapical brush border membranes of HT29 ... A. Roth and Clara G. MonferranDepartamento de Quı´mica Biolo´gica – CIQUIBIC (CONICET), Facultad de Ciencias Quı´micas, Universidad Nacional de Co´rdoba, ArgentinaThe type I heat-labile ... receptorsCorrespondenceC. G. Monferran, Departamento de Quı´micaBiolo´gica, Facultad de Ciencias Quı´micas,Universidad Nacional de Co´rdoba, CiudadUniversitaria, Co´rdoba X5000HUA, ArgentinaFax: +54 351...