the legal structure of the european union as a union of states
Tài liệu Constructing Civil Liberties Discontinuities in the Development of American Constitutional Law pdf
... unrelated areas of the law, reformists were able to create legal doctrine that imagined the spur-ofthe-moment, discretionary acts of local school of cials as matters of “state” action and “state” ... veterans of the struggle, who are kept on the stage as vigilant sentries and reminders of darker days This particular trajectory of progress has an added advantage as a narrative within modern American ... favorable conditions of the statebuilding era, the creation of a national system of education failed, as it had in earlier times At the same time, though, in the wake of the defeat of the statist...
- 402
- 2,108
- 1
Báo cáo y học: " Carotid Intima-media thickness in childhood and adolescent obesity relations to abdominal obesity, high triglyceride level and insulin resistance"
... immunosorbent assay method Fasting plasma glucose (FPG) was measured by glucose oxidase method; fasting plasma insulin (FINS) was measured by radioimmunity assay (Modula Analytics PP, Roche) Both intra-assay ... alanine aminotransferase; AST = aspartate aminotransferase; lg = logarithmical transformation Table Multiple stepwise linear regression analysis, with mean IMT of CCA as the dependent variable and all ... 1.03 mmol/L) Clinical characteristics The body weight was assessed using a calibrated standard balance beam, height was measured by a standard height bar, and BMI was calculated as body weight (kg)...
- 6
- 478
- 0
Báo cáo y học: "Advances in Molecular Diagnosis of HBV Infection and Drug Resistance"
... that decrease the number of handling steps, reduce contamination, and increase throughput and the accuracy of quantification will further enhance the utility of these assays [2,5] Given the varied ... conserved catalytic polymerase /reverse transcriptase domain of the gene [20], located specifically at a locus of four amino acids consisting of tyrosine-methionineaspartate-aspartate, termed the YMDD ... predominate in Asia; D is associated with southern Europe, the Middle East, and India; E is uniquely African; and F is found in Central and South America as well as in Polynesia [48,49] Genotype G has...
- 9
- 590
- 0
Tài liệu Báo cáo khoa học: Preliminary molecular characterization and crystallization of mitochondrial respiratory complex II from porcine heart ppt
... was identified as follows: MSGVRAVSRLLRARRLALTWAQPAASPIGARSFHFTVDGNKR Similarly, the first five residues of the mature Ip N-terminus are AQTAA, and its signal peptide is MAAVVALSLKRWFPATTLGGACLQACRG ... mitochondria Science 277, 60–66 13 Tsukihara T, Aoyama H, Yamashita E, Tomizaki T, Yamaguchi H, Shinzawa-Itoh K, Nakashima R, Yaono R & Yoshikawa S (1995) Structures of metal sites of oxidized ... RT-PCR against the extracted RNA (A) Lanes and 2, total RNA extract (B) Lane 1, nucleotide acid marker DL15000 (TaKaRa); Lane 2, FP subunit (C) Lane 1, nucleotide acid marker DL2000 (TaKaRa); Lane...
- 6
- 469
- 0
Tài liệu Báo cáo khoa học: Effect of sequence polymorphism and drug resistance on two HIV-1 Gag processing sites pdf
... resistance, the cleavage site was considered as R type sequences were assayed as substrates of HIV-1 PR using competitive assays (Table 3) Natural variations of this cleavage site (peptides and ... activity was a linear function of the substrate concentration The standard error for kinetic values was below 20% Active site titration The active amount of enzyme used in the assays was determined ... resistant Gag mutations may occur early in PR inhibitor therapy, soon after the appearance of one (or a few) critical PR mutations, therefore we have characterized the effect of single protease...
- 7
- 480
- 0
Báo cáo " Imperialism of communicative language teaching and possible resistance against it from teachers in Vietnam as an English foreign languages context " doc
... language literature” by Krashen (S.M Gass and L Selinker (2001) [4]) McKay (2002) states that CLT gains its popularity as a contrast to audiolingualism totally basing on behaviorist view of language ... was given top priority All the teachers in the Department had to and still have to adjust themselves to the new tendency Grammar is no more treated as an important part in the classroom What the ... 167-174 as for the purpose of meaningful communication, and language as the means for that purpose The focus of language teaching, therefore, is on the language in use with all the 'stuff' that go...
- 8
- 736
- 2
Xpert MTB/RIF test for detection of pulmonary tuberculosis and rifampicin resistance (Protocol) pptx
... yes, no, or unclear for each of the QUADAS items Statistical analysis and data synthesis The first step in data analysis will be a descriptive analysis of the results of the primary studies For ... bias will be minimal col We will address these outcomes in a section of the discussion and present summary data in additional tables In addition, if data are available, we will prepare a qualitative ... numerator/denominator Type of specimen (may include expectorated, induced, bronchial - All expectorated alveolar lavage (BAL), tracheal aspirates, gastric aspirates) - All induced - All BAL - Multiple...
- 23
- 505
- 0
Current policy instruments, initiatives and management practices
... •Vietnam is remaining as an agricultural based country, whereas the wastewater reuse in agriculture in long traditional practice •Due to fast growing industrialization and urbanization in the country, ... and rehabilitation of sewerage and drainage systems and capacity building for companies engaged in management of O&M • Japan, France, Denmark, Belgium, Switzerland, etc and international financial ... months • Basic parameters of air, water (inland and sea water), soil, solid wastes, noise caused by transportation, and radioactivity are monitored by these stations • Mostly collected data is served...
- 34
- 1,213
- 0
The Founding Fathers, Pop Culture, and Constitutional Law pdf
... enough that we A Fine Romance? Judicial Restraint as a Romance Novel 13 can adopt it as our regulative ideal” and as a justification for the political system, as long as the separation between the ... to an overly sober assessment of the possibility of transforming any legal narrative in the case of Fish and an unsuccessful attempt at transforming a specific legal narrative in the case of Dworkin ... or any other day Thus, the character of Scarlett can be understood as a cautionary figure who represents the problems associated with embracing a standard romantic narrative framework In the last...
- 154
- 527
- 0
Báo cáo khoa học: Role of the plasma membrane leaflets in drug uptake and multidrug resistance ppt
... cytoplasmic leaflet of the plasma membrane takes place only when the release from the plasma membrane into the cytoplasm occurs at a rate similar to that of the flip-flop of dye across the plasma membrane ... prevented the accumulation of dye in the cytoplasmic leaflet of the plasma membrane Only after a prolonged period, TMRM was accumulated in the cytoplasmic leaflet of the plasma membrane, presumably as a ... H Katzir et al to the flip-flop, namely the release of dye into the cytoplasm, can appear to accelerate the rate at which dye accumulation in the cytoplasmic leaflet of the plasma membrane reaches...
- 11
- 383
- 0
Báo cáo khoa học: Molecular basis for substrate recognition and drug ˚ resistance from 1.1 to 1.6 A resolution crystal structures of HIV-1 protease mutants with substrate analogs pptx
... Source, Argonne National Laboratory, and at the beamline X26C of the National Synchrotron Light Source at Brookhaven National Laboratory, for assistance during X-ray data collection Use of the Advanced ... and the side chain of Lys45¢ Furthermore, P3 is Arg in CA-p2 and Thr in p2-NC As a result, the carbonyl oxygen of P3 Arg interacted with the amide of Asp29 instead of the interaction of the amide ... indinavir, and the substrate concentration was determined by converting the absorbance of the substrate to concentration via a calibration curve The decrease in absorbance at 310 nm of the reaction...
- 13
- 302
- 0
Báo cáo hóa học: " Weatherability and Leach Resistance of Wood Impregnated with Nano-Zinc Oxide" pot
... examination and water absorption was determined by a modification of ASTM standard D 1037-9 6a [13] Weathered specimens, both treated and untreated, and unweathered southern pine were conditioned at ... leaching and weathering tests according to American Wood Protection Association (AWPA) and American Standard for Testing and Material (ASTM) standard methods Pre-weighed specimens that were conditioned ... primarily through deposition in pit chambers and on tertiary cell wall layers rather than via chemical reaction [9] In a preliminary study, Clausen et al [7] evaluated the feasibility of nano-zinc...
- 4
- 193
- 0
Báo cáo lâm nghiệp: "ce nucleation and frost resistance of Pinus canariensis seedlings bearing needles in three different developmental states" pptx
... ice The recuperation and survival capacity after frost damage of variable degrees of severity was assessed in whole plant regrowth tests MATERIALS AND METHODS 2.1 Plant material Pinus canariensis ... Percentage frost damage was then plotted against treatment leaf temperatures A classic logistic function was fitted to the data using P-Fit software (Biosoft, Durham, USA) LT50 –values, i.e., the ... Germany) Basic fluorescence, F0 , was determined after sufficient dark adaptation Maximum fluorescence (Fm ) was measured during a 0.8 s saturating flash at 6000 µmol m−2 s−1 Fv /Fm was then calculated...
- 6
- 295
- 0
Báo cáo lâm nghiệp: "Effect of an oil heat treatment on the leachability and biological resistance of boric acid impregnated wood" pps
... 0,25 % 0,5 % (H) % of mass loss % of mass loss 25 16 14 12 10 Control % of mass loss % of mass loss 25 (E) % of mass loss % of mass loss 25 16 14 12 10 % of mass loss % of mass loss 25 Control ... japonica samples, low mortality percents compared to boron amount indicate a lack of accessibility of boron or weak termite attack due to oily aspect of wood (Tab II, available online at www.afs-journal.org) ... glass jars with fungal cultures and waiting 10 days, three samples of the same condition sterilized using gaseous % of initial boron retained after leaching Durability of boric acid/oil treated...
- 6
- 417
- 0
Báo cáo khoa học: "Antimicrobial susceptibility and molecular detection of chloramphenicol and florfenicol resistance among Escherichia coli isolates from diseased chickens" docx
... borcimitnA J sevlac morf detalosi adicotlum alleruetsaP dna acitylomeah alleruetsaP ni ecnatsiser locinehpmarolhc III TAC E alcnaD-sulsahC ,PJ tnofaL ,LJ letraM ,CM sesuacseD-egaseL ,C uaenurB-trossaV ... alcnaD-sulsahC ,S norehcuaB ,A treakceolC 21 2002 ,enyaW ,)sLCCN ylmrof( etutitsnI sdradnatS yrotarobaL dna lacinilC , 2A- 13M ISLC de dn2 dradnatS devorppA ;slaminA morf detalosI airetcaB rof stseT ... aihcirehcsE naiva gnoma slaiborcimitna rehto dna senoloniuq ot ecnatsiser lairetcab fo ecnelaverP J ocnalB ,A aroM ,M ocnalB ,EJ ocnalB 493 -983 ,04 ,2002 loiborciM nilC J eniws latanoen ni aehrraid...
- 5
- 189
- 0
Báo cáo sinh học: "Etiology and antibiotic resistance patterns of community-acquired urinary tract infections in J N M C Hospital Aligarh, India" potx
... insignificant as shown in table Statistical analysis revealed that the data obtained was obeying the normality as well as principle of homogeneity throughout, p-values were also calculated as indicated ... MA has collected the sample and characterized bacterial isolates from UTI with the collaboration of MS MA has performed all the experiments incorporated in this manuscript AUK has designed the ... beta lactamase in urinary isolates Indian J Med Res 2004, 120:553-556 Kumar MS, Lakshmi V, Rajagopalan R: Related Articles, Occurrence of extended spectrum beta-lactamases among Enterobacteriaceae...
- 7
- 320
- 0
Báo cáo khoa học: "Current focuses in woody and drought resistance" docx
... to a vastly improved understanding of the role of storriatal activity in plants has been the acceptance that properties of the water potential equation measured at the bulk leaf level are at best ... et al., 1988; Masle and Passioura, 1987; Munns and King, 1988; Passioura, 1988) have increased our understanding of the importance of the rapid biochemical interaction between the root and the ... sapwood area was measured, the effects of age and site quality could be nicely isolated They hypothesized that age-related increases in saturated sapwood permeability could explain how trees can maintain...
- 8
- 243
- 0
Báo cáo lâm nghiệp: "Water movement and its resistance in young trees of Cryptomeria japonica" pot
... Results On the clear day of August 20th, when the soil was dry, the predawn water potential of leaves was 0.2!.3 MPa lower than the soil On the other hand, the water potential of rootstock was higher ... was a larger diurnal variation of R than of R This variation X sPac is considered to result from the fact that the relative distance of the measuring point for water flow was very close to the ... example of the calculation of eqn effect of reducing the water flow pathway on the index of resistance, l , a was examined, providing that the crosssectional area of sapwood at m high was reduced...
- 5
- 191
- 0
báo cáo khoa học: " Down-regulation of miR-27a might inhibit proliferation and drug resistance of gastric cancer cells" docx
... results of MTT assay and soft agar assay revealed that down-regulation of miR-2 7a inhibited cell growth of gastric cancer cells in vitro, which was consistent with the data of nude mice assay The ... transfection of the antagomirs of miR-2 7a Cells co-transfected with scrambled antago-miR-NC served as controls Statistical analysis All the data were presented as the mean ± SD The significance ... days Soft agar assay Soft agar assay was performed as described previously [5] Each assay was performed in triplicate Tumor growth in nude mice Female athymic nu/nu mice, 5-6 weeks of age, were...
- 5
- 237
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008