0

the basic molecular and structural components of silicate clays a single tetrahedron and single octahedron b thousands of tetrahedrons and octahedrons are connected to give planes of silicon and aluminum or magnesium ions unive

Introduction to the basic approaches and issues of Intrusion Detection

Introduction to the basic approaches and issues of Intrusion Detection

An ninh - Bảo mật

... can raise the < /b> alert to Orange with the < /b> President’s approval; Orange with the < /b> President’s approval; * *President can raise any or all sectors President can raise any or all sectors to Orange at ... criticality of < /b> the < /b> target and < /b> lethality of < /b> the < /b> attack, and < /b> the < /b> effectiveness of < /b> system and < /b> network countermeasures • Impact is calculated by the < /b> analyst • Delays in detection and < /b> reaction can increase ... it may not always be possible to place a < /b> single < /b> sensor at a < /b> point where it can reliably monitor all communications It is possible to build a < /b> network that is virtually impossible to monitor It...
  • 34
  • 445
  • 0
Báo cáo y học:

Báo cáo y học: "Summary The claudin multigene family encodes tetraspan membrane proteins that are crucial structural and functional components of tight junctions, which have important roles in regulating para­ cellular" pdf

Báo cáo khoa học

... variants documented in GenBank are indicated and < /b> other variants may exist serve as a < /b> continuous paracellular seal between the < /b> apical and < /b> basolateral sections [1,21] When observed by freezefracture ... molecular < /b> path­ t ways are just emerging and < /b> will probably become a < /b> major focus of < /b> research in the < /b> field of < /b> claudins and < /b> TJs From a < /b> practical point of < /b> view, a < /b> better under­ tanding of < /b> TJ s formation ... purified as components < /b> of < /b> TJs [20] and < /b> are now known to be essential components < /b> of < /b> TJ structure and < /b> function TJs are found at the < /b> most apical part of < /b> the < /b> lateral surface of < /b> a < /b> sheet of < /b> epithelial cells...
  • 7
  • 348
  • 0
Tài liệu Báo cáo khoa học: Structural effects of a dimer interface mutation on catalytic activity of triosephosphate isomerase The role of conserved residues and complementary mutations pptx

Tài liệu Báo cáo khoa học: Structural effects of a dimer interface mutation on catalytic activity of triosephosphate isomerase The role of conserved residues and complementary mutations pptx

Báo cáo khoa học

... CACCATGGCTAGAAAATATTTTGTCGCAGCAAACTTCAAATGTAA GAACCTTTATTCGCTATTGGTACCGGTAAA GAACCTTTATTCGCTATTGGTACCGGTAAA TCACCGGTCCATGATCCATT NcoI KpnI KpnI HaeIII 4178 FEBS Journal 276 (2009) 41694183 ê 2009 The < /b> Authors ... maintain the < /b> unusual Ramachandran angles for the < /b> K12 residue, and < /b> a < /b> Ramachandran scatter plot for the < /b> K12 residues in 21 TIM structures from various sources (available from the < /b> Protein Data Bank ... Sambrook J & Russell DW (2001) Molecular < /b> Cloning: A < /b> Laboratory Manual, 3rd edn Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY 53 Bradford MM (1976) A < /b> rapid and < /b> sensitive method for...
  • 15
  • 635
  • 0
Tài liệu Báo cáo khoa học: Molecular and cellular specificity of post-translational aminoacyl isomerization in the crustacean hyperglycaemic hormone family docx

Tài liệu Báo cáo khoa học: Molecular and cellular specificity of post-translational aminoacyl isomerization in the crustacean hyperglycaemic hormone family docx

Báo cáo khoa học

... are related to binding to specific receptors or to differences in haemolymphatic clearance rate Indeed, DAACPs are known to be more stable because they are less susceptible to protease degradation ... lobster sinus glands Only the < /b> part of < /b> the < /b> chromatogram where CHHs and < /b> VIHs are eluted is shown The < /b> nature of < /b> the < /b> ultraviolet absorbance peaks was assessed by ELISA as well as by comparison with previously ... were also stained with r-anti-l, the < /b> yellow ⁄ orange colour, variable in a < /b> same organ, attesting to labelling with both antisera For the < /b> sake of < /b> clarity, both types are subsequently referred to as...
  • 13
  • 687
  • 0
Tài liệu Báo cáo khoa học: Cell surface heparan sulfate proteoglycans Target and partners of the basic ®broblast growth factor in rat Sertoli cells pptx

Tài liệu Báo cáo khoa học: Cell surface heparan sulfate proteoglycans Target and partners of the basic ®broblast growth factor in rat Sertoli cells pptx

Báo cáo khoa học

... Proteoheparan sulfate contribute to the < /b> binding of < /b> basic < /b> ®broblast growth factor to its high a< /b> nity receptors on bovine adrenocortical cells Growth Factor 5, 273±282 15 Ornitz, D.M., Yayon, A.< /b> , Flanagan, ... syndecans have been described as coreceptors for this growth factor via a < /b> highly sulfated sequence of < /b> their heparan sulfate chains [34] Sodium chlorate is an inhibitor of < /b> ATP sulfurylase and < /b> hence ... GAGTCGATTCGAGAGACTGA-3¢ 5¢-450 AAAAATGTTGCTGCCCTG-3¢ 5¢-566 GAATGACTCGGAGCGTACACTG-3¢ 5¢-1054 CCTTTGAGCACATTTCGGCAA-3¢ 5¢-1555GCTTCTCATCGCAGAGTATCCGG-3¢ 5¢-1821CAAGGGTAAATTCATTGGGCTTGG-3¢ 5¢-2350 ACAGACTACCTCATGAAGAT-3¢...
  • 10
  • 624
  • 0
Tài liệu Báo cáo Y học: Proteolysis of bovine b-lactoglobulin during thermal treatment in subdenaturing conditions highlights some structural features of the temperature-modified protein and yields fragments with low immunoreactivity pptx

Tài liệu Báo cáo Y học: Proteolysis of bovine b-lactoglobulin during thermal treatment in subdenaturing conditions highlights some structural features of the temperature-modified protein and yields fragments with low immunoreactivity pptx

Báo cáo khoa học

... connects to the < /b> leftovers of < /b> strand D via a < /b> disulfide bridge to Cys66 [5] As stated in the < /b> introduction, one of < /b> the < /b> goals of < /b> this work was to take advantage of < /b> the < /b> interplay of < /b> treatment conditions and < /b> ... In fact, despite the < /b> apparent simplicity of < /b> the < /b> approaches described above, heat denaturation and < /b> aggregation of < /b> BLG upon heat treatment may hide putative sites of < /b> attack from the < /b> action of < /b> proteases, ... multiple-charged ions of < /b> a < /b> separate introduction of < /b> myoglobin Mass values are reported as average masses Quantitative analysis of < /b> individual components < /b> was performed by integrating the < /b> signals from the < /b> multiple...
  • 11
  • 526
  • 0
Tài liệu Báo cáo Y học: Structural determinants of the half-life and cleavage site preference in the autolytic inactivation of chymotrypsin pdf

Tài liệu Báo cáo Y học: Structural determinants of the half-life and cleavage site preference in the autolytic inactivation of chymotrypsin pdf

Báo cáo khoa học

... are shown in blue Asn147 and < /b> Leu13 are not displayed because they are in disordered molecular < /b> regions and < /b> are not visible in the < /b> X-ray structure In the < /b> schematic diagram, the < /b> disulfide bonds are ... FEBS 2001 cleavages of < /b> the < /b> sites were in the < /b> order: Tyr146/Asn147 ! Phe114 ! other sites The < /b> weakness of < /b> bands of < /b> fragments I and < /b> IV and < /b> the < /b> appearance of < /b> fragment II in the < /b> degradation of < /b> the < /b> ... of < /b> experiments, a < /b> q FEBS 2001 Fig Cleavage order of < /b> autolytic sites of < /b> rat D-chymotrypsin The < /b> two domains of < /b> the < /b> molecule are shaded and < /b> the < /b> interdomain and < /b> autolysis loops are boxed The < /b> cleavage...
  • 9
  • 613
  • 0
Tài liệu Báo cáo Y học: Purification, characterization, immunolocalization and structural analysis of the abundant cytoplasmic b-amylase from Calystegia sepium (hedge bindweed) rhizomes ppt

Tài liệu Báo cáo Y học: Purification, characterization, immunolocalization and structural analysis of the abundant cytoplasmic b-amylase from Calystegia sepium (hedge bindweed) rhizomes ppt

Báo cáo khoa học

... built for the < /b> b- amylase from C sepium using the < /b> X-ray coordinates of < /b> the < /b> soybean b- amylase (Fig 4) According to the < /b> Ramachandran plot of < /b> this model the < /b> f and < /b> c angles of < /b> most of < /b> the < /b> residues are ... sepium b- amylase strongly resembles that of < /b> the < /b> soybean [33,39] and < /b> sweet potato [38] b- amylases and < /b> shares the < /b> typical (a/< /b> b) 8 barrel core which is common to all other b- amylases of < /b> different q FEBS ... lines of < /b> barley and < /b> rye, which lack the < /b> endosperm b- amylase, germinate normally [9,43] point towards a < /b> storage role A < /b> similar role has been proposed for the < /b> abundant b- amylase in taproots of < /b> alfalfa,...
  • 11
  • 611
  • 0
COMPONENTS OF REPRODUCTIVE ISOLATION BETWEEN THE MONKEYFLOWERS MIMULUS LEWISII AND M. CARDINALIS (PHRYMACEAE) potx

COMPONENTS OF REPRODUCTIVE ISOLATION BETWEEN THE MONKEYFLOWERS MIMULUS LEWISII AND M. CARDINALIS (PHRYMACEAE) potx

Sức khỏe phụ nữ

... barriers to gradual movement up riparian corridors Second, as described above, M lewisii and < /b> M cardinalis are locally adapted to the < /b> elevations they normally inhabit and < /b> exhibit low fitness in other areas ... pollinator fidelity is best estimated in the < /b> absence of < /b> F1, F2, and < /b> advanced-generation hybrids Although pollinator behavior plays a < /b> major role in isolating M cardinalis and < /b> M lewisii, the < /b> barrier ... not absolute Also, most species pairs in Mimulus section Erythranthe share pollinators and < /b> are probably isolated primarily by ecogeographic and < /b> postmating barriers The < /b> northern and < /b> southern races...
  • 15
  • 662
  • 0
Báo cáo khoa học: Molecular basis of perinatal hypophosphatasia with tissue-nonspecific alkaline phosphatase bearing a conservative replacement of valine by alanine at position 406 Structural importance of the crown domain potx

Báo cáo khoa học: Molecular basis of perinatal hypophosphatasia with tissue-nonspecific alkaline phosphatase bearing a conservative replacement of valine by alanine at position 406 Structural importance of the crown domain potx

Báo cáo khoa học

... 2008 FEBS N Numa et al Molecular < /b> basis of < /b> perinatal form of < /b> hypophosphatasia Table Kinetic parameters of < /b> soluble forms of < /b> the < /b> wild-type TNSALP and < /b> the < /b> TNSALP (V40 6A)< /b> mutant The < /b> assay was carried ... hypophosphatasia, (d) adult hypophosphatasia and < /b> (e) odonto hypophosphatasia [1–4] Perinatal and < /b> infantile forms of < /b> hypophosphatasia are severe and < /b> are usually transmitted as a < /b> recessive trait, whereas the < /b> ... [1–6] To date a < /b> total of < /b> 191 distinct mutations have been reported worldwide, and < /b> about 80% of < /b> these mutations are missense (http://www sesep.uvsq.fr./Database.html) Hypophosphatasia is characterized...
  • 11
  • 500
  • 0
Báo cáo khoa học: Purification and structural analysis of the novel glycoprotein allergen Cyn d 24, a pathogenesis-related protein PR-1, from Bermuda grass pollen pot

Báo cáo khoa học: Purification and structural analysis of the novel glycoprotein allergen Cyn d 24, a pathogenesis-related protein PR-1, from Bermuda grass pollen pot

Báo cáo khoa học

... STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLA 44 Hordeum MQTPKLVILLALAMSAAMVNLSQAQNSP YVSP AA AVG.GAVS.S.K.Q 54 Triticum MQTPKLAILLALAMSAAMANLSQAQNSP Y.SP AA AVG.GAV S.K.Q 54 Zea -MAPRLACLLALAMAAIVVAPCTAQNSP ... Kurosaka A,< /b> Yano A,< /b> Itoh N, Kuroda Y, Nakagawa T & Kawasaki T (1991) The < /b> structure of < /b> a < /b> neural specific carbohydrate epitope of < /b> horseradish peroxidase recognized by anti-horseradish peroxidase antiserum ... Q CAG T ACC Q CAA K AAG P CCG K AAG S TCC H CAC W TGG M ATG ACG C TGC G GGT E GAG T ACC E GAA A < /b> GCC L CTC K AAG G GGC Y TAC K AAG I ATC B Cyn d 24 CGT I ATC G GGA A < /b> GCG R AGG G GGA I ATA T ACG...
  • 10
  • 665
  • 0
Báo cáo khoa học: Purification and structural study of the b form of human cAMP-dependent protein kinase inhibitor pdf

Báo cáo khoa học: Purification and structural study of the b form of human cAMP-dependent protein kinase inhibitor pdf

Báo cáo khoa học

... of < /b> the < /b> individual amide I¢ component bands, determined by band fitting of < /b> the < /b> absorbance spectrum of < /b> Fig 4A,< /b> are shown in Fig and < /b> Table From Table 2, the < /b> sum of < /b> individual amide I¢ intensity and < /b> ... protein and < /b> one might expect the < /b> above solution structure to be reflected in Fig The < /b> 1652 and < /b> 1270 cm)1 bands can be assigned to a-< /b> helix in the < /b> human PKIb; the < /b> 1666 and < /b> 1247 cm)1 bands are the < /b> characteristic ... Table According to the < /b> activity assay, the < /b> activity was retained above 95% (data not shown) and < /b> the < /b> recovery is 24% during the < /b> heat-treatment It implied that PKIb was a < /b> thermostable protein and...
  • 6
  • 531
  • 0
Báo cáo khoa học: Molecular and functional characterization of novel CRFR1 isoforms from the skin pptx

Báo cáo khoa học: Molecular and functional characterization of novel CRFR1 isoforms from the skin pptx

Báo cáo khoa học

... AAAGAAGCCCTGTACTGAATGGTCTCAG-3¢), and < /b> exons 13 and < /b> 14 by primers E16 (5¢-CATTCAGTAC AGGGCTTCTTTGTGTCTGTG-3¢) and < /b> E17 (5¢-AA GAATTCTCATCCCCCCAGCCACAG-3¢) The < /b> full sequence was obtained by combining ... with EcoRI and < /b> XhoI The < /b> insert was synthesized with primers P764 (5¢-AACTCGAGGCTAGTCTGCAGGAGCTCAAGCT TTCTAGAGAATTCA-3¢) and < /b> P765 (5¢-TGAATTCTC TAGAAAGCTTGAGCTCCTGCAGACTAGCCTCGA GTT-3¢) It was also ... washed twice in TBST and < /b> once in TBS Bands were visualized by ECL reagent (Amersham Pharmacia Biotech) according to the < /b> manufacturers’ instructions (Amersham Pharmacia Biotech) CRF and < /b> urocortin...
  • 10
  • 671
  • 0
Báo cáo khoa học: Molecular dynamics structures of peptide nucleic acidÆDNA hybrid in the wild-type and mutated alleles of Ki-ras proto-oncogene ppt

Báo cáo khoa học: Molecular dynamics structures of peptide nucleic acidÆDNA hybrid in the wild-type and mutated alleles of Ki-ras proto-oncogene ppt

Báo cáo khoa học

... Rathinavelan and < /b> N Yathindra Fig 10 Dependence of < /b> backbone .base hydrogen bond interactions in PNA on a < /b> and < /b> e correlation Note that hydrogen bond between N1¢ (backbone) and < /b> base (O2 ⁄ N3) may be ... when they are part of < /b> DNA chain (Fig S3E–H of < /b> the < /b> Supplementary material) Periodic box of < /b> TIP3P waters and < /b> 14 Na+ counter ions to neutralize the < /b> charge on the < /b> DNA strands of < /b> the < /b> hybrids are added ... Yathindra Fig S1 Bar diagram illustrating the < /b> normalized frequency of < /b> different backbone (A< /b> F) and < /b> side chain (G–I) torsion angles of < /b> the < /b> PNA strand of < /b> PDwt (red) and < /b> PDmut (black) Fig S2 Partial charges...
  • 16
  • 382
  • 0
Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx

Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx

Báo cáo khoa học

... Isoform Size (kb) Primer sequence VBARP-L 1.9 VBARP-S 1.3 AACAATGCTGACTGATAGCGGAGGA (Forward) TAAGCTACTACGTAAAGAATATATC (Reverse) GATAAGGTACCTGCACTGACACGGATGAAAGC (Forward) CATATATTCTTTACGTAGTAGCTTA ... of < /b> ANKHD1 splice variant A < /b> B Fig Expression of < /b> VBARP isoforms in vitro and < /b> in vivo: (A)< /b> In vitro transcription ⁄ translation of < /b> VBARP-L and < /b> VBARP-S One microgram of < /b> VBARP-L, VBARP-S and < /b> vector ... to PP2500 and < /b> ANKHD1 variant In this study we focus on the < /b> biochemical and < /b> functional characterization of < /b> the < /b> novel VBARP-L and < /b> VBARP-S transcripts Bioinformatics analyses show that VBARP-L and...
  • 12
  • 561
  • 0
Báo cáo khoa học: Structural flexibility of the methanogenic-type seryl-tRNA synthetase active site and its implication for specific substrate recognition pptx

Báo cáo khoa học: Structural flexibility of the methanogenic-type seryl-tRNA synthetase active site and its implication for specific substrate recognition pptx

Báo cáo khoa học

... 5¢-GATACTTATCTCCATTGATGCTCACAGCCTGGAACTCAAGC 5¢-GGCTTGAGTTCCAGAATGTGGCCATCAATGGAGATAAG 5¢-CTTATCTCCATTGATGGCCACATTCTGGAACTCAAGCC 5¢-AATGGCTTGAGTTCCAGGCTGTGGCCATCAATGGAGATAAGTATC 5¢-ATACTTATCTCCATTGATGGCCACAGCCTGGAACTCAAGCCATTC ... 5¢-CCAGTAATCGGGATCCGCTGTCTGCGGAGG 5¢-CCCACAGGTATGCGAGTGGTGGAATTCACGG 5¢-CCGTGAATTCCACCACTCGCATACCTGTGGG 5¢-CCACAGGTATGAGAGTGTTGCAATTCACGGAATCGAAAGG 5¢-CCTTTCGATTCCGTGAATTGCAACACTCTCATACCTGTGG 5¢-CGGAATCGAAGCGGTCGACGAGTTCCACAGG ... 5¢-CGGAATCGAAGCGGTCGACGAGTTCCACAGG 5¢-CCTGTGGAACTCGTCGACCGCTTCGATTCCG 5¢-GAAAAGCAAGAGTTACCCCCGCGTTTATGGCACAGGAAG 5¢-CTTCCTGTGCCATAAACGCGGGGGTAACTCTTGCTTTTC 5¢-GCTTGAGTTCCAGGCTGTGAGCATCAATGGAGATAAGTATC 5¢-GATACTTATCTCCATTGATGCTCACAGCCTGGAACTCAAGC...
  • 14
  • 357
  • 0
Báo cáo khoa học: Structural study of the catalytic domain of PKCf using infrared spectroscopy and two-dimensional infrared correlation spectroscopy pot

Báo cáo khoa học: Structural study of the catalytic domain of PKCf using infrared spectroscopy and two-dimensional infrared correlation spectroscopy pot

Báo cáo khoa học

... region and < /b> the < /b> quantitative contribution of < /b> each band to the < /b> total amide I¢ contour was obtained by band curve fitting of < /b> the < /b> original spectra The < /b> major component in the < /b> amide I¢ region appears at ... obtaining the < /b> ratio between the < /b> absorbance values at 1550 (amide II) and < /b> at 1515 cm)1, which corresponds to tyrosine (Fig 1A)< /b> The < /b> band at 1515 cm)1 was used to normalize the < /b> data because it was ... D2O+ATP (80 °C) a < /b> Peak position of < /b> the < /b> amide I band components < /b> b Percentage area of < /b> the < /b> amide I band components < /b> The < /b> area corresponding to side chain contributions located at 1600–1615 cm)1 has...
  • 14
  • 383
  • 0
Báo cáo khoa học: Kinetic studies and molecular modelling attribute a crucial role in the specificity and stereoselectivity of penicillin acylase to the pair ArgA145-ArgB263 pdf

Báo cáo khoa học: Kinetic studies and molecular modelling attribute a crucial role in the specificity and stereoselectivity of penicillin acylase to the pair ArgA145-ArgB263 pdf

Báo cáo khoa học

... substrates The < /b> data for the < /b> PA catalysed hydrolysis of < /b> PhAc-Asp and < /b> PhAc-Glu [13] and < /b> our data for PhAc-pAB, PhAc-mAB and < /b> PhAcoAB (Table 2) imply that the < /b> COOH group has to be positioned as in NIPAB ... O atoms of < /b> the < /b> main chain CO groups of < /b> LeuB387 and < /b> TrpB240, Od1 atom of < /b> AsnB241, and < /b> Oc atom of < /b> SerB386 and < /b> is expected to stabilize the < /b> positive charge of < /b> ArgB263 All of < /b> these views remain arguable, ... between the < /b> polar CO2– and < /b> O(NO) and < /b> positively charged guanidinium fragments of < /b> ArgA145 and < /b> ArgB263 ˚ Table Distances (A)< /b> between polar substrates groups (CO2– and < /b> A < /b> NO2) and < /b> the < /b> two ArgB263 and < /b> ArgA145...
  • 8
  • 438
  • 0
Báo cáo khoa học: Interaction of the E2 and E3 components of the pyruvate dehydrogenase multienzyme complex of Bacillus stearothermophilus ppt

Báo cáo khoa học: Interaction of the E2 and E3 components of the pyruvate dehydrogenase multienzyme complex of Bacillus stearothermophilus ppt

Báo cáo khoa học

... owing to an absence of < /b> detectable long-range NOEs in the < /b> NMR spectrum The < /b> availability of < /b> uniformly 15N-labelled PSBD enabled us now to analyse the < /b> backbone dynamics using a < /b> steady-state [1H]-15N ... backbone resonances of < /b> the < /b> uncomplexed PSBD and < /b> PSBD bound to E3int indicate that several amino acids near the < /b> N-terminus of < /b> helix I of < /b> the < /b> PSBD are at or near the < /b> E3-binding site, confirming and < /b> ... Val129 to Ala168, but residues Asn126, Arg127 and < /b> Arg128 appear to be partly mobile Structure determination of < /b> PSBD Because the < /b> backbone dynamics experiment revealed that residues 117–125 and < /b> 171 of...
  • 10
  • 558
  • 0
Báo cáo khoa học: Mercury(II) binding to metallothioneins Variables governing the formation and structural features of the mammalian Hg-MT species pptx

Báo cáo khoa học: Mercury(II) binding to metallothioneins Variables governing the formation and structural features of the mammalian Hg-MT species pptx

Báo cáo khoa học

... into two new broad overlapping bands with absorption maxima at  230 and < /b> 320 nm; (b) the < /b> next Hg(II) eq added to the < /b> three peptides gives rise to a < /b> negative broad band with absorption minima at ... chromophores in the < /b> same species including Zn and/< /b> or Hg as metal ions and < /b> SCys and/< /b> or Cl– as ligands; (b) the < /b> absence of < /b> well-established relationships between most of < /b> the < /b> previous chromophores and < /b> the < /b> ... standard variables (pH of < /b> the < /b> solution, reaction time, and < /b> binding Table Influence of < /b> the < /b> reaction time (t) and < /b> binding ability of < /b> the < /b> counter -ions (X) on the < /b> nature and < /b> structural < /b> features of < /b> the...
  • 9
  • 396
  • 0

Xem thêm