... dark green and shiningabove, the margins recurved: flowers in clusters terminating the branch-lets: petals i/> in. long including the recurved tips, nearly black: fruitingpeduncle stout, ... Publications in Botany. [VOL. 414 in. wide, obscurely 1- or 3-nerved: flowers pink or rose-color, in denseterminal heads 1 in. or more in diameter, the axis seldom growing outbefore flowering is ... the minute foliage:leaves exceedingly minute, mostly in whorls of 3, closely appressed tothe stem, ovate, scale-like: flowers in small globular heads about y± in- in diameter: capsules in...
... participating in the design process:O = organizationalP = personal 4. Time-to-delivery:1 = course already begun or is about to begin2 = beginning in between 2 and 4 months3 = beginning in more ... engineering in design, a useful technique in cases where it is dicult to identify the objectives a faculty member actually wishes to set or in cases where the professor is not inclined to invest ... working with subject matter experts who were intent on oering their courses at a distance and/or online. Finally, I wish to recognize Valerie Cliord () for an inspiring book review in...
... opposed regulations affecting local industry.An obvious rationale for the relative unimportance of variations in compliance costs in explaining congressional voting is that intraindustryimpacts were ... producers, but would influencethe marginal economics of this industry. By influencing marginal eco-nomics, it would significantly impact the quasirents of existing producers—indeed, it would likely ... important both in determining the total cost of imposing regulations and in affecting thestructure of the industry. For example, if short-run effects fall predomi-nantly on small, marginal producers,...
... planning, definition and design, formulation, the formal approach, preliminary engineering, and preliminary design. It covers project organizing, planning, scheduling, estimating, and budgeting. ... disputes. Several arbitration bodies, including the International Chamber of Commerce, were involved to help bring the various competing sides to the bargaining table in an attempt to resolve key portions ... realizing the risks involved and setting up the original RFP with the objective of rewarding the “promoters”—and, in turn, the contractors at all levels—for achieving the goals determined by...
... eliminating church court jurisdictions. Aggressivejustices were completely involved in the realm of government and politics, sincelaw was the primary instrument the state had to maintain or ... thetransformation of life taking place in the locality. Bishops found themselvescompletely subordinated to the crown, but in a better position to regulateparish life. Inserting the rector back into the parish ... around the king necessarily reverberated in mundane parish life.Law wove the local situation together with the events instituted in Londonand Westminster. In some ways over the preceding century...
... theory (increased earningscoming from additional investment in training and education) do not hold in the secondary sector (King, 1990), a series of awareness and training programmescontinue to ... hereafter invented, including photocopying andrecording, or in any information storage or retrieval system, withoutpermission in writing from the publishers.British Library Cataloguing in Publication ... net increase in self-employmentover 1979–91, though that meant an 80 per cent increase in self-employment in the manufacturing industries (Employment Gazette, 1991). The increase in manufacturing...
... tosixyears0.ThePhDinvolvesindependentresearchwhichisundertakenundertheguidanceofoneormoresupervisors.NewZealandPhDsfollowtheBritishmodelofbeingawardedonthethesisalong;thethesiswillbe100,000wordsandmustmakeasignificantandoriginalcontributiontothediscipline.OURACADEMICSTAFFHAVESPECIALISTKNOWLEDGE IN ANUMBEROFAREASINCLUDING:• InternationaleconomicandbusinesshistoryincludingtheAsia‐Pacificregion• ... nSACL)http://www/Victoria.ac.nz/sacl/MA.History(withinHistory)http://www/victoria.ac.nz/historyForfurtherinformationseehttp://www.victoria.ac.nz/fgr/prospective‐phdsandhttp://www.victoria.ac.nz/fgr/mastersTheEconomic,AccountingandBusinesshistoryNetworkalsorunsaseminarseries,producesworkingpapersandhaslinkstoanumberofresearchinstitutionsaroundtheworld.Formoreinformationpleasevisitourwebsitehttp://www.victoria.ac.nz/sef/researchNETWORKCOORDINATORDrLarryLepperSchoolofEconomicsandFinanceEmail:larry.lepper@vuw.ac.nzPhone:+64021460585STUDENTANDACADEMICSERVICESPhone:+6444635376Fax:+6444635360Email:fca‐sa0@vuw.ac.nzLevel1,RailwayWestWingPipiteacampusWellington6011NewZealandVictoriaUniversityofWellingtonPOBox600Wellington6140NewZealandINTERNATIONALSTUDENTCONTACTVictoriaInternationalPhone:+6444635350Fax:+6444635056Email:Victoria‐international@vuw.ac.nzWebsite:http://www.victoria‐international.ac.nzPHDANDMASTER’S STUDIESIN ECONOMIC,ACCOUNTINGANDBUSINESSHISTORY.Economic,AccountingandBusinessHistoryNetwork(BEAN)VictoriaUniversityofWellington,NewZealandisaleadingresearchandlearningcentre in theAsia‐Pacificregionforthestudyofeconomic,accountingandbusinesshistory.Atotalof10academicsstaffworking in theseareasaretobefound in theSchoolofEconomicsandFinance(SEF);theSchoolofAccountingandCommercialLaw(SACL);andtheSchoolofHistory,Philosophy,PoliticalScienceandInternationalRelations(History).TheuniversityoffersMaster’sandPhDdegrees in economics,history,accountingandhistory.Studentscanchoosetopics in economicsaccountingandbusinesshistoryforthosedegr ... nSACL)http://www/Victoria.ac.nz/sacl/MA.History(withinHistory)http://www/victoria.ac.nz/historyForfurtherinformationseehttp://www.victoria.ac.nz/fgr/prospective‐phdsandhttp://www.victoria.ac.nz/fgr/mastersTheEconomic,AccountingandBusinesshistoryNetworkalsorunsaseminarseries,producesworkingpapersandhaslinkstoanumberofresearchinstitutionsaroundtheworld.Formoreinformationpleasevisitourwebsitehttp://www.victoria.ac.nz/sef/researchNETWORKCOORDINATORDrLarryLepperSchoolofEconomicsandFinanceEmail:larry.lepper@vuw.ac.nzPhone:+64021460585STUDENTANDACADEMICSERVICESPhone:+6444635376Fax:+6444635360Email:fca‐sa0@vuw.ac.nzLevel1,RailwayWestWingPipiteacampusWellington6011NewZealandVictoriaUniversityofWellingtonPOBox600Wellington6140NewZealandINTERNATIONALSTUDENTCONTACTVictoriaInternationalPhone:+6444635350Fax:+6444635056Email:Victoria‐international@vuw.ac.nzWebsite:http://www.victoria‐international.ac.nzPHDANDMASTER’S STUDIESIN ECONOMIC,ACCOUNTINGANDBUSINESSHISTORY.Economic,AccountingandBusinessHistoryNetwork(BEAN)VictoriaUniversityofWellington,NewZealandisaleadingresearchandlearningcentre in theAsia‐Pacificregionforthestudyofeconomic,accountingandbusinesshistory.Atotalof10academicsstaffworking in theseareasaretobefound in theSchoolofEconomicsandFinance(SEF);theSchoolofAccountingandCommercialLaw(SACL);andtheSchoolofHistory,Philosophy,PoliticalScienceandInternationalRelations(History).TheuniversityoffersMaster’sandPhDdegrees in economics,history,accountingandhistory.Studentscanchoosetopics in economicsaccountingandbusinesshistoryforthosedegr...
... tracked into homes in significant quantities from exterior soil that was contaminated by historical use of lead in paint, gasoline, or industries. Drinking Water Lead occurs in drinking water ... cited in AAP 1993) • grinding or cutting equipment during processing Packaging Lead in packaging may contaminate food. • Bright red and yellow paints on bread bags and candy may contain lead ... Historic or ongoing lead-related industries (including mining and smelting) can result in high lead levels in surrounding soil. Progress Check 2. In older urban areas, most of the lead in the environment...
... cross-sectional studies. In such studies, methodological quality may be defined as the confidence that the study design, conduct and analysis has minimised biases in estimating the accuracy of the test in ... reference test. In addition, accuracy studies require that observers assessing gold standards verifying the diagnosis be blinded to measurements obtained from the test and vice versa. Blinding avoids ... However potentially misleading summary LRs might be obtained from pooling LRs obtained from studies with extreme and diverging prevalence. An alternative way of summarising the average performance...
... Outside of a Clinic Visit?Table 2 - Recommended actions occurring following clinical message indicating new family history informationNew information provided by patients led to an increasedrisk ... BrazilxxviiDiscovering New Biomedical Knowledge: Machine Learning and Data MiningBiomedical Knowledge Discovery with Topological Constraints Modeling in Bayesian Networks: A Preliminary Report 560 ... Online® search results for SodiumTo minimize maintenance and gain sensitivity of the infor-mation retrieved given a variety of user interests, theinformation hyperlink avoids tight coupling...
... and discipline in other domains. In addition to changes in individual conduct and power relations within human societies, the transitions from foraging to farming and hunting to herding had significantrepercussions ... found in cosmetics. Moisturising creams, for instance, often containcollagen or the animal proteins reticulin and elastin; hair conditioners are made usingkeratin, an animal protein obtained ... change in theological thinking, from the mid-eighteenth century onwards, there was increasinginterest in the welfare of the animals used by human society, which in turn was supportedby a growing...
... the business plan as preparation for launching a business venture, managing the business and obtaining investor dollars.Finances for Entrepreneurs and Small Business OwnersEvery budding entrepreneur ... important information about applying for your visa, paying your fees, and enrolling in Fundamental Studiesin Business and Entrepreneurship. Please be sure to carefully read this information, ... and develop your interviewing skills. Securing the internship requires interviewing for the position, just as you would interview for a full-time job. Once you obtain an internship, a program...
... transfer. The project required the following:•A complete renovation of a formulation and filling suite, including a new separate air-handling systemCase Studiesin Pharmaceutical Project ManagementA ... project management in outsourcing, several industry members provided case studies on how to coordinate, organize, and implement a successful project. Blow/fill/seal manufacturingNorman Weichbrodt, ... manufacturing team.Execution. To date, all of the engineer-ing, stability, and process-validation batches have met the in- process and final-product test specifications. With nine batches...