solidstate fermentation of sweet sorghum to ethanol in a rotarydrum fermenter
An investigation into some types of verbal responses to questions in English and Vietnamese conversation
... elicitation of data from a large sample of subjects relatively easily, using the same situations where contextual variables can be controlled. It is a good way to gain insight into social factors ... commodity called face. Face is defined as consisting of the freedom to act unimpeded (Negative Face) and the satisfaction of having one’s value approved of (Positive Face). To maintain face requires ... evidence he has. In (27), there is a clash of non-observance of the maxim of Quantity and Quality. A great number of similar cases are available in Vietnamese. These patterns of responses are rich,...
- 42
- 1,062
- 4
Báo cáo khoa học: Contributions to catalysis and potential interactions of the three catalytic domains in a contiguous trimeric creatine kinase doc
... [19] catalytic activity. Interestingly,maximal activity of domain 2 was achieved only whendomain 1 was functional, reinforcing, once again, theidea that catalysis at one active site is affected ... theTSAC, it is reasonable to speculate that closing of oneactive site is structurally linked to substrate binding in the second. Stated another way, formation of theTSAC in one active site may act ... interactions to inhibit the binding and closing of any other activesites that are in communication with the closed site, issimple and appealing and goes some distance towardsexplaining the asymmetry in...
- 9
- 567
- 0
The Economic Effects of Restricted Access to Land in the West Bank ppt
... still await approval in the West Bank (Jenin, Ramallah, and Abu Dis). Sources: Interviews and information with Palestinian Water Authority, Ministry of Planning, and Palestinian Energy Authority ... The broad range is due to the method of estimation which can vary widely since many Palestinian villages are located partially in Area A and B on the one hand, and partially in Area C, so it ... southwest of Ramallah, is one of many examples of a vital link now closed to the Palestinians21. 13. In total, the land area of the West Bank restricted from Palestinian use adds up to 38.3% of...
- 48
- 529
- 0
The Economic Effects of Restricted Access to Land in the West Bank pdf
... still await approval in the West Bank (Jenin, Ramallah, and Abu Dis). Sources: Interviews and information with Palestinian Water Authority, Ministry of Planning, and Palestinian Energy Authority ... PROSPECTS OF AREA C 31. As discussed in the previous section, the land administration and planning system maintained by the GOI in Area C is problematic in terms of providing adequate Palestinian access ... population in Area C has been estimated to be anywhere between 70,000 and 230,000 people48. Area C naturally incorporates most rural areas and grazing land, so a large part of the population are...
- 48
- 598
- 0
DETERMINANTS OF CREDIT TO HOUSEHOLDS IN A LIFE-CYCLE MODEL pdf
... more interesting for our investigation, is how changes in individual un-certainty a ect the process of capital accumulation, the level of the real interest rate16 Table 7: Data sourcesvariable ... capital-output ratio is negative, which leads to an increase in the real interest rate. This further leads to a contraction in demandfor credit. In our model a change of ρ from 0.96 to 0.98 leads to a decrease ... is diminished, which leads to a decline in the stock of capital. An increase of the replacement ratio from 0.4 to 0.6 decreases thecapital-output ratio from 2.643 to 2.533 and raises the interest...
- 43
- 1,098
- 0
A survey of technology thinkers and stakeholders shows they believe the internet will continue to spread in a “flattening” and improving world. There are many, though, who think major problems will accompany technology advances by 2020 doc
... cost' makes economic assumptions about the back sides of mountains in Afghanistan and the behavior of entrepreneurs in Africa.” Adrian Schofield, head of research for ForgeAhead, an information ... power to a game and … the place that I call 'game world' today may develop into much more than a game in the near future. It may become just another place for the mind to be, a new and ... collected, and an email invitation was also issued to these people to participate. This created an additional snowball sample of respondents, whose ideas are also included in the final data. The...
- 115
- 441
- 0
báo cáo hóa học:" Dimensions and correlates of quality of life according to frailty status: a cross-sectional study on community-dwelling older adults referred to an outpatient geriatric service in Italy" ppt
... Additional file 1).Correlates of QOL according to frailty status In the total sample several variables, including frailty,were significantly associated with a worse QOL at univar-iate analyses (Table ... community-dwelling older adults referred to an outpatient geriatric service in ItalyClaudio Bilotta*1, Ann Bowling2, Alessandra Casè1, Paola Nicolini1, Sabrina Mauri1, Manuela Castelli1 and ... par-ticipants were similar in the three QOL-related groups. A P-value less than or equal to 0.05 was assumed to indicatestatistical significance.As far as multivariate analyses in the total sample wereconcerned,...
- 10
- 351
- 0
Báo cáo lâm nghiệp: "An analysis of ecophysiological responses to drought in American Chestnut" ppt
... experimentally, Ecology 73 (1992)2129–2144.[27] Nagakura J., Shigenaga H., Akama A. , Takahashi M., Growth andtranspiration of Japanese cedar (Cryptomeria japonica) and Hinokicypress (Chamaecyparis ... bal-ance between transpiration and photosynthesis when soil wa-ter availability declined, suggesting that American chestnut isadapted to tolerate water deficit. This trait, if maintained in the ... destructive leaf harvesting on the mainstudy plants and a rapid means to assess plant water status [4, 13, 35].2.1.2. Leaf gas exchangePrior to arrival at a moisture status of 0.10 m3m−3 (a value...
- 10
- 302
- 0
Báo cáo khoa học: "Gastric outlet obstruction due to adenocarcinoma in a patient with Ataxia-Telangiectasia syndrome: a case report and review of the literature" pdf
... ataxia-telangiectasia patients is usually atypical, leading to delays in diagnosis.Case presentation: We report the case of a 20 year old ataxia-telangiectasia patient with gastricadenocarcinoma ... Naika noRyôiki (Domain of Internal Medicine) 1975, 35:623-626.15. Watanabe A, Hanazono H, Sogawa H, Takaya H: Stomach cancer of a 14-year-old boy with ataxia-telangiectasia. Tohoku J ExpMed 1977, ... chronic gastritis and intestinal metaplasia seem to lead to the development of gastric adenocarcinoma. One should consider adenocarcinoma in any patientwith ataxia-telangiectasia who presents with...
- 5
- 598
- 0
Enhancement of tolerance development to morphine in rats prenatally exposed to morphine, methadone, and buprenorphine docx
... basal forebrain, brainstem, and spinal cord, andwhich may play important roles in maturation of stressand pain circuitry [44]. It is also a type of pain-relatedreceptor that is involved in ... obtained similar antinociceptiveresponse and development of tolerance to morphine in prenatally methadone- and morphine-exposed offspring.The morphine-induced tolerance in prenatally metha-done-exposed ... decreases analgesia but not K+ channel activation. Neuroreport 2003, 14:239-242.18. O'Callaghan JP, Holtzman SG: Prenatal administration of morphine to the rat: tolerance to the analgesic...
- 10
- 230
- 0
báo cáo khoa học: "Complete clinical response of metastatic hepatocellular carcinoma to sorafenib in a patient with hemochromatosis: A case report" ppsx
... typessuch as renal cell carcinoma, melanoma, thyroid cancer,ovarian cancer, sarcoma, and pancreatic cancer. None of these tumor types is characterized by elevated alpha-feto-protein or imaging characteristics ... seen in reported clinical trials of sorafenib. In the SHARP trial, 83% of the 902 patients in the study hadprotocol deviation due to a variety of reasons. The originaldosing of sorafenib called ... remission has not beenobserved in clinical trials of sorafenib in patients withrenal cell carcinoma. Preliminary studies have shown ananti-tumor activity of sorafenib in a variety of tumor typessuch...
- 3
- 206
- 0
báo cáo khoa học: " Intein-mediated site-specific conjugation of Quantum Dots to proteins in vivo" pdf
... (QDs) to targetproteins in vivo. This approach allows the covalent conjugation of any nanostructure and/ornanodevice to any protein and thus the targeting of such material to any intracellular ... (IC-Biotin)H-MVKVIGRRSLGVQRIFDIGLPQDHNFLLAN-GAIAANCFDYKDDDDK(Ahx-Biotin)G-NH2 Modifica-tions: Biotin conjugated to lysine via a Ahx linker (6carbon inert linker) A 47 amino acid peptide correspond-ing to C-terminal intein (IC) ... confir-mation of in vivo targeting and localization and ii) theirpotential as a bio-imaging tool. In contrast to traditionalfluorophores, QD's act as robust, broadly tunable nanoe-mitters that can...
- 9
- 203
- 0
Tìm thêm: xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế điều tra đối với đối tượng giảng viên và đối tượng quản lí nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng 9 tr 25