plotting a parametric function

Báo cáo khoa hoc:" Estimating genetic covariance functions assuming a parametric correlation structure for environmental effects" pdf

Ngày tải lên : 09/08/2014, 18:21

... covariance models are available, but usually involve more parameters A common model, available in standard statistical analyses packages, is the so-called “ante-dependence” model [15] A more parsimonious ... A3 r1 A3 r1 A3 r1 A3 r2 A3 r2 A3 r2 A3 r2 A3 r2 A4 r1 A4 r1 A4 r1 A4 r2 A4 r2 A4 r2 A4 r2 A4 r2 A4 r3 A4 r3 Model (c) Table III continued Parametric correlation structure 579 580 K Meyer Figure Estimates of (average) ... having 1, 2, , and records available 4.2 Analyses Data were analysed assuming a parametric correlation structure for covariances between records taken on the same animal Models CS, EXP, GAU,...

29
210
0

the meaning and structure of a narrative a systemic functional analysis

Ngày tải lên : 07/09/2013, 13:48

... language as central (what language does and how language does it) rather than placing the elements of language and their combination (known as structural approaches) as central With in SFL, language ... communicative aspect of language 2.4 Metafunctions Halliday developed a theory of the fundamental functions of language into three broad metafunctions: ideational, interpersonal, and textual Each ... Re-examine some of the most important issues related to the experiential aspect of functional grammar Analyze the meaning and structure of a narrative based on the systemic functional analysis...

39
826
2

Tài liệu Báo cáo " The meaning and structure of a science fiction story: a sysyemic functional analysis " doc

Ngày tải lên : 12/02/2014, 20:20

... declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative ... declarative declarative declarative declarative declarative declarative declarative declarative imperative declarative declarative Modality ability/neg ability/pos ability/neg ability/neg ability/neg ... relational was III Senser mental see Existent relational were Actor material descended Actor material landed Actor material put on Goal Actor material opened Goal Actor material climbed 10 Actor material...

18
712
4

Tài liệu Báo cáo khoa học: Mixed lineage leukemia: a structure–function perspective of the MLL1 protein ppt

Ngày tải lên : 16/02/2014, 14:20

... p300 are general transcriptional co-activators that contain histone and transcription factor acetylation activities [30] In addition, CBP contains a number of protein-binding domains that mediate ... part by a Research Scholar Grant (RSC-09-245-01-DMC) from the American Cancer Society and by NIH grant number R01CA140522 from the National Cancer Institute (to MSC) We thank Venkat Dharmarajan ... association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF Cell 121, 873–885 17 Yokoyama A, Wang Z, Wysocka J, Sanyal M, Auﬁero DJ, Kitabayashi I,...

11
761
0

Đề tài " Approximating a bandlimited function using very coarsely quantized data: A family of stable sigma-delta modulators of arbitrary order " pptx

Ngày tải lên : 05/03/2014, 23:20

... Annals of Mathematics, 158 (2003), 679–710 Approximating a bandlimited function using very coarsely quantized data: A family of stable sigma-delta modulators of arbitrary order By Ingrid Daubechies ... DEVORE , Approximating a bandlimited function using very coarsely quantized data: Improved error estimates in sigma-delta modulation, J Amer Math Soc., to appear ¨ ¨ C S Gunturk, J C Lagarias, and ... both cases, one can prove that there exists a bounded set Aa ⊂ R2 so that if |xn | ≤ a for all n, and (u0 , v0 ) ∈ Aa , then (un , ) ∈ Aa for all n ∈ N; see [19] APPROXIMATING A BANDLIMITED FUNCTION...

33
258
0

Báo cáo khoa học: Nup358, a nucleoporin, functions as a key determinant of the nuclear pore complex structure remodeling during skeletal myogenesis docx

Ngày tải lên : 06/03/2014, 01:20

... (5¢-GATCTCCTCTTCAGCTA CCACCGCTTGAGAGACTTACTCTTGATTGTAACGA GGATA-3¢ and 5¢-AGCTTATCCTCGTTACAATCAA GAGTAAGTCTCTCAAGCGGTGGTAGCTGAAGAGG A- 3¢) were annealed and inserted into the BglII and HindIII sites of pEGFP-NLS ... 5¢-AUAAGUAAUUUCUACGACG dTdT-3¢; Nup358, 5¢-CCAGUCACUUACAAUUAAAd TdT-3¢ and 5¢-UUUAAUUGUAAGUGACUGGdTdT-3¢ (siNup358-1), 5¢-UGAAGCACAUGCUAUAAAAdTdT-3¢ and 5¢-UUUUAUAGCAUGUGCUUCAdTdT-3¢ (siNup358-2)] Transfection ... localization of HDAC4 orchestrates muscle differentiation Nucleic Acids Res 29, 3439–3447 22 Yasuhara N, Shibazaki N, Tanaka S, Nagai M, Kamikawa Y, Oe S, Asally M, Kamachi Y, Kondoh H & Yoneda...

12
454
0

Báo cáo khoa học: Interactions between metals and a-synuclein ) function or artefact? pptx

Ngày tải lên : 07/03/2014, 10:20

... to cause disease These mutations are associate with early onset of the disease and has the pathology includes LBs and is autosomal dominant [21] a- synuclein a- synuclein is a small (14 kDa), highly ... Hulihan M et al (2004) Alpha-synuclein locus duplication as a cause of familial Parkinson’s disease Lancet 364, 1167–1169 18 Masliah E, Rockenstein E, Veinbergs I, Mallory M, Hashimoto M, Takeda A, ... to the parkinsonian neurotoxin MPTP Proc Natl Acad Sci USA 99, 14524–14529 43 Chandra S, Fornai F, Kwon HB, Yazdani U, Atasoy D, Liu X, Hammer RE, Battaglia G, German DC, Castillo PE et al (2004)...

9
467
0

Báo cáo khoa học: Death inducer obliterator protein 1 in the context of DNA regulation Sequence analyses of distant homologues point to a novel functional role docx

Ngày tải lên : 07/03/2014, 21:20

... shown Black geometrical shapes are additional domains, as indicated ANOGA, Anopheles gambiae; ASHGOS, Ashbya gossypii; BRARE, Brachydanio rerio; CANDGLA, Candida glabrata; CIONA, Ciona intestinalis; ... Flodin A & Skalnik DG (2000) Cloning of a mammalian transcriptional activator that binds unmethylated CpG motifs and shares a CXXC domain with DNA methyltransferase, human trithorax, and methyl-CpG ... that DIDO-related apoptosis occurs as a result of alterations in DNA regulation caused by chromatin instability Computational analyses Although all splice variants share common domains, long regions...

7
658
0

Quantifying Aesthetic Form Preference in a Utility Function pot

Ngày tải lên : 16/03/2014, 18:20

... shows that an attribute has a particular parametric value range that is preferred ͑It is speciﬁcally not stated that the exact parametric value for the attribute could be determined As in all utility ... 15͒, functions only have a short parametric range for neutral designs But, convex and concave functions ͑Figs 10, 12, and 14͒ all have two separate parametric ranges, where the utility function ... attribute has a squared, a linear, and a constant term with a separate weight, ␤ij, for each term of the function where xi is the parametric value of the atomic attribute ͑Eq ͑2͒͒ While the quadratic...

10
318
0

Báo cáo khoa học: " Parsing the Wall Street Journal using a Lexical-Functional Grammar and Discriminative Estimation Techniques" doc

Ngày tải lên : 23/03/2014, 20:20

... goal of estimation is to nd model pa1 An earlier approach using partially labeled data for estimating stochastics parsers is Pereira and Schabess (1992) work on training PCFG from partially bracketed ... constraintbased grammars (in contrast to treebank grammars): the symbolic grammar already signicantly restricts/disambiguates the range of possible analyses, giving the disambiguator a much narrower ... in a small number of cases Note that since for the evaluation on the Brown corpus, no heldout data were available to adjust the variance parameter of a Bayesian model, we used a plain maximumlikelihood...

8
477
0

Báo cáo khoa học: Identiﬁcation of the N-terminal region of TjZNT2, a Zrt⁄Irt-like protein family metal transporter, as a novel functional region involved in metal ion selectivity ppt

Ngày tải lên : 29/03/2014, 00:20

... -MASSPTKILCDAGESDLCRDDAAAFLLKFVAIASIL 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF TjZNT1 TjZNT2 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFA ... Thlaspi caerulescens as a model system Ann Bot 102, 3–13 Weber M, Harada E, Vess C, Roepenack-Lahaye E & Clemens S (2004) Comparative microarray analysis of Arabidopsis thaliana and Arabidopsis halleri ... transport FEBS Lett 581, 2263–2272 N-terminus of TjZNT2 is involved in ion selectivity Tomatsu H, Takano J, Takahashi H, Watanabe-Takahashi A, Shibagaki N & Fujiwara T (2007) An Arabidopsis thaliana...

8
343
0

Báo cáo khoa học: Homologous expression of a bacterial phytochrome The cyanobacterium Fremyella diplosiphon incorporates biliverdin as a genuine, functional chromophore doc

Ngày tải lên : 30/03/2014, 08:20

... TTGGTTCGCGATCTGAATTCGTCAAGTCCACCTC-3¢ The primers used for H26 7A were: oBQ144-2, 5¢-CACT CGGTACTCCGCAGCGTTTCGCCGTTARCCATTGAA TATTTGCACAATATGG-3¢ (R ¼ purine); and oBQ145-2, 5¢-CCATATTGTGCAAATATTCAATGGYTAACGGCG ... was termed pPL9b CphBm was ampliﬁed from genomic DNA from PCC7601 using primers oBQ146 (5¢-TATACCATGG GCTTAAGTCCTGAAAATTCTCCAG-3¢) and oBQ147 (5¢-AAACTCGAGCCGGCCCTCAATTTTGACCTCCTGC AATGTGAAATAGAACG-3¢), ... other cyanobacteria [9], e.g Calothrix PCC7601 [10] and Anabaena PCC7120, and also in proteobacteria such as Deinococcus radiodurans, Pseudomonas aeruginosa [3,11] and Agrobacterium tumefaciens...

11
440
0

Báo cáo khoa học: An asymmetric ion channel derived from gramicidin A Synthesis, function and NMR structure ppt

Ngày tải lên : 30/03/2014, 15:20

... around 222 nm (Fig 3A) indicates a random-coil structure In methanol, two positive maxima were observed at 209 and 230 nm (Fig 3A) These two maxima are characteristic of a parallel right-handed ... and TOCSY resulted in assignments of the side chains The molecule has a special structural motif: asymmetric with similarity in chains A and B (chain B ¼ Val-Gly-Ala-d-Leu-chainA; Fig 1) As a ... the standard library of dyana In the 3–Cs+ complex, chains A and B are connected head-to-head by succinic acid, in such a way that the molecule entity starts from a C-terminus and ends at another...

12
446
0

Báo cáo hóa học: " On the Ulam-Hyers stability of a quadratic functional equation" ppt

Ngày tải lên : 20/06/2014, 22:20

... Khodaei, H: On the generalized Hyers-Ulam-Rassias stability of quadratic functional equations Abst Appl Anal 2009 (2009) Article ID 923476 13 Ravi, K, Rassias, JM, Arunkumar, M, Kodandan, R: Stability ... true quadratic mapping near an approximately quadratic mapping Theorem 3.2 Assume that a mapping f : X ® Y satisfies f(0) = and inequality (3.3) Then there exists a unique quadratic mapping Q ... Ulam-Hyers stability of the quadratic functional equation Recently, Shakeri, Saadati and Park [10] investigated the Ulam-Hyers stability of Equation (1.1) in non-Archimedean L -fuzzy normed spaces...

9
362
0

Báo cáo y học: "Correction: Biofabrication of anisotropic gold nanotriangles using extract of endophytic Aspergillus clavatus as a dual functional reductant and stabilizer" potx

Ngày tải lên : 21/06/2014, 04:20

1
252
0

Báo cáo hóa học: " Research Article Intuitionistic Fuzzy Stability of a Quadratic Functional Equation" pptx

Ngày tải lên : 21/06/2014, 07:20

... stability of the linear transformation in Banach spaces,” Journal of the Mathematical Society of Japan, vol 2, pp 64–66, 1950 T M Rassias, “On the stability of the linear mapping in Banach spaces,” ... Press, Palm Harbor, Fla, USA, 2003 10 D H Hyers, G Isac, and T M Rassias, Stability of Functional Equations in Several Variables, Progress in Nonlinear Diﬀerential Equations and their Applications, ... Theory and Applications The paper of Rassias has provided a lot of inﬂuence in the development of what we called the generalized Hyers-Ulam-Rassias stability of functional equations In 1990, Rassias...

7
348
0

Báo cáo hóa học: " Biofabrication of Anisotropic Gold Nanotriangles Using Extract of Endophytic Aspergillus clavatus as a Dual Functional Reductant and Stabilizer" potx

Ngày tải lên : 21/06/2014, 08:20

... Vigneshwaran N, Ashtaputre NM, Varadarajan PV, Nachane RP, Paralikar KM, Balasubramanya RH: Mat Lett 2007, 61:1413 17 Bhainsa KC, D’Souza SF: Coll Surf B Biointer 2006, 47:160 18 Shankar SS, Ahmad A, ... Pinches A: Gold Bull 2006, 39:22 13 Mukherjee P, Ahmad A, Mandal D, Senapati S, Sainkar SR, Khan MI, Ramani R, Parischa R, Kumar PAV, Alam M, Sastry M, Kumar R: Angew Chem Int Ed 2001, 40:3585 14 Ahmad ... Cite this article as: Verma et al.: Biofabrication of Anisotropic Gold Nanotriangles Using Extract of Endophytic Aspergillus clavatus as a Dual Functional Reductant and Stabilizer Nanoscale Res...

7
261
0

Báo cáo hóa học: " Research Article Stability of a Quadratic Functional Equation in the Spaces of Generalized Functions" docx

Ngày tải lên : 22/06/2014, 02:20

... cubic functional equation in the spaces of generalized functions,” Journal of Inequalities and Applications, vol 2007, Article ID 79893, 13 pages, 2007 15 Pl Kannappan, “Quadratic functional equation ... Journal of Mathematical Analysis and Applications, vol 222, no 1, pp 126–137, 1998 17 L Hormander, The Analysis of Linear Partial Diﬀerential Operators I Distribution Theory and Fourier ¨ Analysis, ... T Matsuzawa, A calculus approach to hyperfunctions III,” Nagoya Mathematical Journal, vol 118, pp 133–153, 1990 21 K W Kim, S.-Y Chung, and D Kim, “Fourier hyperfunctions as the boundary values...

12
311
0

Báo cáo hóa học: " Research Article A Multidimensional Functional Equation Having Quadratic Forms as Solutions" pot

Ngày tải lên : 22/06/2014, 11:20

... Hyers-Ulam-Rassias stability in Banach modules over a C ∗ -algebra,” Journal of Mathematical Analysis and Applications, vol 294, no 1, pp 196– 205, 2004 [4] J.-H Bae and W.-G Park, “On stability of a functional ... have the quadratic property,” Journal of Mathematical Analysis and Applications, vol 222, no 1, pp 126–137, 1998 [6] W.-G Park and J.-H Bae, “On a bi-quadratic functional equation and its stability,” ... of an n-dimensional quadratic functional equation,” Journal of Mathematical Analysis and Applications, vol 258, no 1, pp 183–193, 2001 [3] J.-H Bae and W.-G Park, “On the generalized Hyers-Ulam-Rassias...

8
150
0

Báo cáo hóa học: "Research Article A Multidimensional Functional Equation Having Quadratic Forms as Solutions" pptx

Ngày tải lên : 22/06/2014, 11:20

... Hyers-Ulam-Rassias stability in Banach modules over a C ∗ -algebra,” Journal of Mathematical Analysis and Applications, vol 294, no 1, pp 196– 205, 2004 [4] J.-H Bae and W.-G Park, “On stability of a functional ... have the quadratic property,” Journal of Mathematical Analysis and Applications, vol 222, no 1, pp 126–137, 1998 [6] W.-G Park and J.-H Bae, “On a bi-quadratic functional equation and its stability,” ... of an n-dimensional quadratic functional equation,” Journal of Mathematical Analysis and Applications, vol 258, no 1, pp 183–193, 2001 [3] J.-H Bae and W.-G Park, “On the generalized Hyers-Ulam-Rassias...

8
239
0