... dissemination, KU=knowledge use)RESEARCH ARTICLE Knowledge and Process Management 240 R. McAdam &Research ArticleKnowledge Managementasa Catalystfor Innovation within Organizations: A Qualitative ... ownideas in small teams).RESEARCH ARTICLE Knowledge and Process Management 236 R. McAdam `Knowledge management really is a necessarycondition before you can innovate.'The participants ... willdisseminate and embody new knowledge farbeyond the organizational boundaries, leading toincreased innovative partnerships and alliances(Nonaka and Takeuchi, 1995).If organizations are to systematically...
... 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIFTjZNT1 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFATjZNT2 74:LAGAAGVAIPLIGRNRRFLQTDGSLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPEFPWKKFPFPGFFATjZNT1 ... Harada E, Vess C, Roepenack-Lahaye E &Clemens S (2004) Comparative microarray analysis ofArabidopsis thaliana and Arabidopsis halleri roots identi-fies nicotianamine synthase, a ZIP transporter ... 322330.2 Kraămer U, Talke I & Hanikenne M (2007) Transitionmetal transport. FEBS Lett 581, 2263–2272.3 Tomatsu H, Takano J, Takahashi H, Watanabe-Takah-ashi A, Shibagaki N & Fujiwara T...
... (5Â-TATACCATGGGCTTAAGTCCTGAAAATTCTCCAG-3Â) and oBQ147(5Â-AAACTCGAGCCGGCCCTCAATTTTGACCTCCTGCAATGTGAAATAGAACG-3Â), and cloned between theNcoI and XhoI sites into pET2 8a( +), providing a His-tag inthe C-terminus ... 5Â-CATATGACGAATTGCCATCGCGAACC-3Â; and oBQ36, 5Â-GGATCCTTATTTGACCTCCTGCAATGTGAAATAG-3Â (restriction sitesare underlined, and start and stop codons are given in bold).The PCR product was then ... cyano-bacteria [9], e.g. Calothrix PCC7601 [10] and AnabaenaPCC7120, and also in proteobacteria s uch a s Deinococcusradiodurans, Pseudomonas aeruginosa [3,11] and Agro-bacterium tumefaciens...
... readers than I should in writing of him as an Artist. Besides, as an artist hehas been done a great deal already; and a commercial state like ours has really more concern in him as a business man. ... page. He knows that there is always a dangerthat the reigning favorite may fail to please; that at any rate, in the order of things, he is passing away, and thatif the magazine is not to pass ... hispresent low grade among business men. As I have hinted, it is but a little while that he has had any standing at all. I may say that it is only since thewas that literature has become abusiness with...
... programming, data entry and the implementation of database projects. This group is managed by its Team Leader and its operations are overseen by the Project Manager. Case Study: Paramount Business ... experience has shown that somewhere around 30-40 tasks are about right, but that it is very important to insist on the use of summary tasks as well as detail tasks. Case studies have included: an office ... documentation for a TPS, SuperFast Consultancy Services – fast dial-up directory services and a PC-LAN installation at the Department of Administrative Affairs. After this part of the assignment has been...
... Place your nametag on your right; it's easier to read when shaking hands (since most are right-handed). 4. Actively greet others. 5. Give a strong handshake. 6. Prepare an “elevator ... belle loves and loses and loves again a slyly dashing war profiteer as she struggles to protect her family and beloved plantation. ã A pig raised by sheepdogs, learns to herd sheep with a little ... Key Attributes of a Great Sale Make a list of the 3 attributes or personal characteristics of a successful salesperson based on your observations of top salespeople you’ve met… Attributes...
... withpre-equilibrated Ni ⁄ nitrilotriacetate ⁄ agarose (Qiagen, Valen-cia, CA, USA), and rocked at 4 °C for 1 h. The lysate ⁄ Ni ⁄nitrilotriacetate bead mixture was transferred to a poly prepchromatography ... physiological ratherthan an artifact of lysis. These results also support,using a visual rather than molecular biochemicalapproach, the proposal that PMA triggers increasedinteraction between PLD1 and ... functions asa signal terminatorfor H2O2-activated phospholipase D1Nianzhou Xiao, Guangwei Du and Michael A. FrohmanDepartment of Pharmacology and the Center for Developmental Genetics,...
... RevNES (5Â-GATCTCCTCTTCAGCTACCACCGCTTGAGAGACTTACTCTTGATTGTAACGAGGATA-3Â and 5Â-AGCTTATCCTCGTTACAATCAAGAGTAAGTCTCTCAAGCGGTGGTAGCTGAAGAGG A- 3Â) were annealed and inserted into the BglII and HindIIIsites ... and 5Â-AUAAGUAAUUUCUACGACGdTdT-3Â; Nup358, 5Â-CCAGUCACUUACAAUUAAAdTdT-3Â and 5Â-UUUAAUUGUAAGUGACUGGdTdT-3Â(siNup358-1), 5Â-UGAAGCACAUGCUAUAAAAdTdT-3Âand 5Â-UUUUAUAGCAUGUGCUUCAdTdT-3Â (siNup-358-2)]. ... Differential localization ofHDAC4 orchestrates muscle differentiation. NucleicAcids Res 29, 3439–3447.22 Yasuhara N, Shibazaki N, Tanaka S, Nagai M, Kamik-awa Y, Oe S, Asally M, Kamachi Y,...
... a water molecule which can then accelerate thedisplacement of the protonated superoxide anion, as wassuggested by Tsuruga and Shikama [21] to explain theincrease in oxidation rate of the a ... (data not shown). As was observed previouslyby others [5], the reaction is biphasic at pH 7.4 and below,with an initial fast phase followed by a slower phase. Todetermine the optimum pH at ... metHb. Theamount of hemichrome produced during a 2-h reaction wastypically less than 10% (data not shown). The decrease inconcentration of oxyHb with time was utilized asa measureof the rate of...
... grammar can be affected in isolation from other aspects of language function. (Cf Studies of agrammatic and Broca's aphasia as described in Goodenough, Zurif, and Weintraub, 1977; Goodglass, ... any information associated with a name, for instance, an activity value, is viewable from any spaces in which the name exists. This means that any interpreted meaning associated with a name ... to the grammatical representation is that the syntactic category aspect of each meaning of a phonetic word is also a part of the grammatical representation where it makes associations with...
... shaft, can gauge 223.1.3.5 Thermal Mechanical Analysis A TA Instruments DMA 2980 was used in penetration mode to measure the Tg ofthe PMMA films cast on silicon. Each sample was placed into a ... maintaining constant amplitude of oscillation as the surface height changes. A laser beam records the deflection of the cantilever beam as the tip rasters along the surface. Typically a height image, ... compared. The 100c samplehad a contact angle of 91.2°. The surface washed in chloroform was more polarcompared that washed in toluene as illustrated by the 12.6° decrease in the contact angleof...
... IMPLEMENTATION OF LEXICAL FUNCTIONAL GRAMMAR AS A BASE FOR A NATURAL LANGUAGE PROCESSING SYSTEM Werner Frey and Uwe Reyle Department of Llngulstlcs University of Stuttgart W-Germany O. ABSIRACr ... logical relations? Recall that each clause has a unique head end that the functional features of each phrase are identified with those of its head. For (3) the head of S -~> NPVP is the VP and ... semantic representation of the already analyzed discourse S(1), ,S(i-l) as well as on a database containing the knowledge the text talks about. ~ requirement is of major importance for the analysis...
... peptide was constructed as follows. TheDNA fragment was amplified from GmPDIM cDNA byPCR using the primers 5Â-GACGACGACAAGATGCACGCACTCTATGGAGC-3Â and 5Â-GAGGAGAAGCCCGGTTCATAGCTCATCCTTGCTTGAAG-3Â. ... RNase A PDI activity was assayed by measuring RNase activity pro-duced through the regeneration of the active form fromreduced and denatured RNase A. Reduced and denaturedRNase A was prepared ... soybean cotyledons during matu-ration. (A) GmPDIM mRNA was quantified by real time RT-PCR.Each value was standardized by dividing the value by that for actinmRNA. Values are calculated asa percentage...
... helicase A interacts with nuclear factor jB p65 and functions as a transcriptional coactivatorToshifumi Tetsuka1, Hiroaki Uranishi1, Takaomi Sanda1, Kaori Asamitsu1, Jiang-Ping Yang2,Flossie ... of California San Diego, La Jolla, CA, USARNA helicase A (RHA), a member of DNA and RNAhelicase f amily containing ATPase activity, is involved inmany steps of gene expression such as transcription ... (siRNA) 5Â-GCAUAAAACUUCUGCGUCU-3Â was targeted to the RHA portion from 2408 to2426. Control siRNA 5Â-AUUCUAUCACUAGCGUGAC-3Â was purchased from Dharmacon (Lafayette, CO,USA). siRNA transfections...
... TG, transglutaminase.FEBS Journal 272 (2005) 615–631 ª 2004 FEBS 615 132 Akagi A, Tajima S, Ishibashi A, Matsubara Y, Takeh-ana M, Kobayashi S & Yamaguchi, N. (2002) Type XVIcollagen is ... will cast light onthe functions of transglutaminases and their involvement in human dis-eases. In this paper we review data on the properties of mammalian trans-glutaminases, particularly as ... relevanceCarla Esposito and Ivana CaputoDepartment of Chemistry, University of Salerno, ItalyMammalian transglutaminases andtheir catalytic activityTransglutaminases (TGs; EC 2.3.2.13) are encoded...