marjorie apos s busy days by carolyn wells author of the quot patty quot books

The Project Gutenberg EBook of Marjorie''''s Busy Days, by Carolyn Wells pot

The Project Gutenberg EBook of Marjorie''''s Busy Days, by Carolyn Wells pot

Ngày tải lên : 28/06/2014, 17:20
... GOLD-FISH, SHE VARIOUS SORTS, BUT NONE SEEM Busy Days MARJOR BUSY DA BY CAROLYN W AUTHOR O THE "PATTY" GROSSET & D PUBLISHERS N Made in the United State Copyright, 19 By Dodd, Mead & C Published, ... propelled by a series of hitches The shipwrecked sufferers thus made their way toward the desert island There were several narrow escapes from drowning, but they generously assisted each other, and ... rescued they must be by actual outsiders Unless, indeed, they could build a raft and save themselves, but this they had never accomplished The desert island was selected, and this time they chose...
  • 569
  • 411
  • 0
By the Light of the SoulMary Eleanor Wilkins-Freeman..By the Light of the Soul A Novel By Mary E. Wilkins Freeman Author of “The Debtor” “The Portion of Labor” “Jerome” “A New England Nun” Etc. etc.1907To Harriet and Carolyn Alden..By the Light o pptx

By the Light of the SoulMary Eleanor Wilkins-Freeman..By the Light of the Soul A Novel By Mary E. Wilkins Freeman Author of “The Debtor” “The Portion of Labor” “Jerome” “A New England Nun” Etc. etc.1907To Harriet and Carolyn Alden..By the Light o pptx

Ngày tải lên : 16/03/2014, 18:20
... classes There was always a sort of moral strike going on against Maria, as there is against all superiority, especially when the superiority is known to be recognized by the possessor thereof ... because of those cases She watched the doctor limp up the steps with positive malevolence “If he is such a smart doctor, why doesn’t he cure himself?” she asked She heard steps on the stairs, then ... imagination She 20 By the Light of the Soul thought to herself that her mother might never put on those clothes again She kissed the folds of her mother s dress passionately, and emerged from the closet,...
  • 488
  • 398
  • 0
Tài liệu LUYỆN ĐỌC TIẾNG ANH QUA TÁC PHẨM VĂN HỌC-SHORT STORY BY O’HENRY Seats Of The Haughty ppt

Tài liệu LUYỆN ĐỌC TIẾNG ANH QUA TÁC PHẨM VĂN HỌC-SHORT STORY BY O’HENRY Seats Of The Haughty ppt

Ngày tải lên : 26/01/2014, 18:20
... the two St Louis topics, the water supply and the colour line They mix the two subjects so fast that strangers often think they are discussing water-colours; and that has given the old town something ... mingle with the set that carries a Spitz, wears spats, and hits the ground in high spots.' "Solly puts six thousand dollars in century bills in one pocket of his brown ducks, and bills of lading ... out of the sky falls two fine gold watches in the middle of the street One hits a chunk of mud and sticks The other falls hard and flies open, making a fine drizzle of little springs and screws...
  • 19
  • 493
  • 0
Tài liệu Deteriorating Access to Women’s Health Services in Texas: Potential Effects of the Women’s Health Program Affiliate Rule doc

Tài liệu Deteriorating Access to Women’s Health Services in Texas: Potential Effects of the Women’s Health Program Affiliate Rule doc

Ngày tải lên : 13/02/2014, 06:20
... progress as a result of these decisions The state of Texas has sued CMS to prevent the loss of federal funds and a group of Planned Parenthood clinics has sued the state to prevent implementation of ... rise several-fold Paradoxically, as the number of WHP patients who can continue to be served climbs, the state s budget losses grow larger These are estimates based on some basic assumptions; the ... affiliate has a billing address in Dallas County, but some of its sites are in other adjacent counties and some of the patients served may be residents of other counties The list does not indicate...
  • 27
  • 712
  • 0
Tài liệu Effect modification of air pollution on Urinary 8-Hydroxy-2’-Deoxyguanosine by genotypes: an application of the multiple testing procedure to identify significant SNP interactions ppt

Tài liệu Effect modification of air pollution on Urinary 8-Hydroxy-2’-Deoxyguanosine by genotypes: an application of the multiple testing procedure to identify significant SNP interactions ppt

Ngày tải lên : 17/02/2014, 22:20
... from the observed data The program generates B bootstrap samples from hypotheses M and obtains M × B samples or M × B matrix of test statistics Then, based on the M × B matrix of test statistics, ... inputting sequence containing the SNP site and 100 bp of flanking sequence on either side of the SNP Assays were genotyped using the Sequenom MassArray MALDI-TOF mass spectrometer (Sequonom, CA, USA) ... We selected family-wise error rate and step-down maxT methods in this study In step-down procedures, the hypotheses corresponding to the most significant test statistics are considered successively,...
  • 9
  • 772
  • 0
Tài liệu Báo cáo khóa học: Non-specific depolymerization of chitosan by pronase and characterization of the resultant products pptx

Tài liệu Báo cáo khóa học: Non-specific depolymerization of chitosan by pronase and characterization of the resultant products pptx

Ngày tải lên : 19/02/2014, 12:20
... chitosan from the offal of marine food processing industry (and pronase), and show the biofunctionalities of these materials Acknowledgements Authors thank Dr S Subramanian (Indian Institute of Science, ... chito-oligomers as one of the products and a drastic decrease in molecular mass of chitosan indicates an endo-type activity of pronase Addition of hexosaminidase (specific for the release of GlcNAc from the ... proteolysis, whereas, the chitosanolytic activity was inhibited by only 30%, which suggested the involvement of a serine residue in this nonspecific catalysis As a serine protease, pronase bears a...
  • 11
  • 673
  • 0
As Required by Section 939(h) of the Dodd-Frank Wall Street Reform and Consumer Protection Act ppt

As Required by Section 939(h) of the Dodd-Frank Wall Street Reform and Consumer Protection Act ppt

Ngày tải lên : 06/03/2014, 08:20
... http://www.standardandpoors.com/ratings/form-nrsro/en/us 15 As discussed above, the Commission stated in 2005 that similarities in the scales and symbols used by NRSROs “suggests the existence of a market-based standard.” 52 The following ... across asset classes because the underlying assessment is the same regardless of asset class—that is, the likelihood that the bond obligations will be repaid in accordance with their terms.” ... publish a variety of other types of credit ratings and assessments using various scales and measures Each of the three largest NRSROs has dozens of rating scales For example, Fitch, among other...
  • 60
  • 477
  • 0
As Required by Section 702(b) of the Sarbanes-Oxley Act of 2002 potx

As Required by Section 702(b) of the Sarbanes-Oxley Act of 2002 potx

Ngày tải lên : 15/03/2014, 07:20
... address them 120 The Commission is mindful that some of the concepts discussed in this report may raise questions about the limits of the Commission s authority We will, of course, consider those ... from issuers for rating their securities 19 the marketing by the NRSROs of ancillary services to issuers, such as pre-rating assessments and corporate consulting, thereby heightening the NRSROs’ ... The Commission is mindful that some of the concepts discussed in this report may raise questions about the limits of the Commission s authority We will, of course, consider those issues carefully...
  • 48
  • 430
  • 0
Báo cáo khoa học: Probing the catalytic potential of the hamster arylamine N-acetyltransferase 2 catalytic triad by site-directed mutagenesis of the proximal conserved residue, Tyr190 pot

Báo cáo khoa học: Probing the catalytic potential of the hamster arylamine N-acetyltransferase 2 catalytic triad by site-directed mutagenesis of the proximal conserved residue, Tyr190 pot

Ngày tải lên : 16/03/2014, 00:20
... addition, the impact of the most disruptive mutant, Tyr to Ala, at this position on the active site structure was characterized by NMR spectroscopy Results CD spectroscopy and HSQC analyses of 15 ... superimposed Consistent with the CD spectra, the amide resonances of most of the residues in secondary structural elements were unperturbed; however, the Y190A mutation caused nearly all of the ... pKa1transacetyl of active site His would be matched by that of the associated altered Asp122 To address this issue we carried out protein NMR structural studies of the most altered mutant, Y190A The...
  • 14
  • 350
  • 0
Báo cáo khoa học: Regulation of luteinizing hormone receptor mRNA expression by mevalonate kinase – role of the catalytic center in mRNA recognition potx

Báo cáo khoa học: Regulation of luteinizing hormone receptor mRNA expression by mevalonate kinase – role of the catalytic center in mRNA recognition potx

Ngày tải lên : 16/03/2014, 06:20
... previous studies have shown that binding of MVK to LHR mRNA suppresses the translation of mRNA in vitro [14] As the mutation of any of the four amino acids at the active site of MVK decreases its ... between substrate and RNA binding is a reasonable hypothesis Two structural scenarios that explain the present mutagenesis data are as follows: (a) the RNA binding site overlaps with the site of ATP ... examined by western blot analysis using MVK antibody Figure 2A shows the overexpression of all the single mutants and wild-type MVK, and Fig 2B shows the overexpression of all the double mutants and...
  • 11
  • 367
  • 0
Báo cáo khoa học: Probing the mechanism of the bifunctional enzyme ketol-acid reductoisomerase by site-directed mutagenesis of the active site pot

Báo cáo khoa học: Probing the mechanism of the bifunctional enzyme ketol-acid reductoisomerase by site-directed mutagenesis of the active site pot

Ngày tải lên : 16/03/2014, 18:20
... was purified in the same way as that expressed by pET-C Catalytic properties The specific activities of the wildtype and mutants in the reductoisomerase, reductase, and reverse isomerase assays ... different but sequential reactions at a single active site [1] One of the main purposes of this study was to try to dissect the two reactions by mutagenesis of active site residues, expecting ... this is a pattern that is observed for several other mutants and no special function of E393 can be proposed on the basis of the results presented here Two of the mutants (D217E and E221Q) showed...
  • 10
  • 339
  • 0
Retrieval of the source location and mechanical descriptors of a hysteretically-damped solid occupying a half space by full wave inversion of the the response signal on its boundary doc

Retrieval of the source location and mechanical descriptors of a hysteretically-damped solid occupying a half space by full wave inversion of the the response signal on its boundary doc

Ngày tải lên : 18/03/2014, 01:21
... MNI of the SM In this case, when the values of all the parameters of the set P are strictly equal to their counterparts in the set p and the values of all the parameters of the set N are strictly ... results of these operations, for various discordances, are given in tables 2-6 Each row in the tables represents the last in the series of (usually of the order of five) operations for diminishing ... processed in the inversion scheme, was obtained by numerical simulation The underlying physical-mathematical model thereof is a supposedly-rigorous solution (expressed by a double integral) of the...
  • 26
  • 467
  • 0
Báo cáo khoa học: Regulation of translational efficiency by different splice variants of the Disc large 1 oncosuppressor 5¢-UTR potx

Báo cáo khoa học: Regulation of translational efficiency by different splice variants of the Disc large 1 oncosuppressor 5¢-UTR potx

Ngày tải lên : 22/03/2014, 16:20
... analysis of the sequence demonstrated the presence of consensus sites for a potential alternative splicing, and the presence of a uORF in the putative alternative spliced exon These findings seem ... However, analysis of the exon sequences at the splicing boundaries shows that even though the 3¢ splice site matches perfectly with the mammalian consensus (GT), the 5¢ site CG is not the optimal ... validating the 5¢ RACE results Different 5¢-UTRs define the translational efficiency of the messages To address the functional impact of these UTRs on the DLG1 mRNA transcripts, and their influence on the...
  • 13
  • 332
  • 0
Protecting Children''''s Health In A Changing Environment - Report Of The Fifth Ministerial Conference On Environment And Health.pdf potx

Protecting Children''''s Health In A Changing Environment - Report Of The Fifth Ministerial Conference On Environment And Health.pdf potx

Ngày tải lên : 22/03/2014, 16:22
... posters The incidence of diarrhoeal diseases has dropped and recycling covers the costs of the actions Lessons to be shared The panel of ministers and the EU representative shared their experiences, ... can assess changes and propose new policies The lessons learnt in Hungary serve as an example of progress in countries; the process has enabled the country to build its own policies, based on the ... understanding of stakeholders’ perceptions in the area of risk assessment, for instance Although many issues – such as the benefits of physical activity (31) or the adverse effects of night noise (32)...
  • 92
  • 501
  • 0
Báo cáo khoa học: MBP-1 is efficiently encoded by an alternative transcript of the ENO1 gene but post-translationally regulated by proteasome-dependent protein turnover doc

Báo cáo khoa học: MBP-1 is efficiently encoded by an alternative transcript of the ENO1 gene but post-translationally regulated by proteasome-dependent protein turnover doc

Ngày tải lên : 29/03/2014, 21:20
... kidney tissues, the MBP-1 mRNA was exclusively highly abundant in spleen, and was rarely found in stomach and colon tissues These results suggest that the expressions of ENO1 and FEBS Journal ... we suggest that this newly discovered transcript is a genuine template for the synthesis of the MBP-1 tumor suppressor in cells Discussion Fig The native ENO1 transcript preferentially encodes ... or typeset Technical support issues arising from supporting information (other than missing files) should be addressed to the authors FEBS Journal 277 (2010) 4308–4321 ª 2010 The Authors Journal...
  • 14
  • 361
  • 0
Báo cáo khoa học: Regulation of the muscle-specific AMP-activated protein kinase a2b2c3 complexes by AMP and implications of the mutations in the c3-subunit for the AMP dependence of the enzyme docx

Báo cáo khoa học: Regulation of the muscle-specific AMP-activated protein kinase a2b2c3 complexes by AMP and implications of the mutations in the c3-subunit for the AMP dependence of the enzyme docx

Ngày tải lên : 30/03/2014, 08:20
... c3 is equivalent to the R302Q substitution in c2, the dominant isoform of the c-subunit in the heart The R302Q mutation, together with several other substitutions identified in CBS domains of the ... asterisks, which were expressed in COS7 cells In (B) and (C), equivalent amounts of AMPK were used, as estimated by western blot analysis (A) The particular subunit isoforms present in the AMPK ... highly sensitive to the possible presence of any traces of AMP, either endogenous or as a Regulation of AMPK a2b2c3 complexes by AMP A B C result of the presence of AMP-generating proteins as contaminants...
  • 10
  • 553
  • 0
Báo cáo sinh học: " Inhibition of Henipavirus fusion and infection by heptad-derived peptides of the Nipah virus fusion glycoprotein" doc

Báo cáo sinh học: " Inhibition of Henipavirus fusion and infection by heptad-derived peptides of the Nipah virus fusion glycoprotein" doc

Ngày tải lên : 19/06/2014, 08:20
... (HR-2) of the NiV F glycoprotein, was chosen for synthesis: KVDISSQISSMNQSLQQSKDYIKEAQRLLDTVNPSL (NiV FC2) A scrambled version of the 36-amino-acid peptide was also synthesized for use as a negative ... Paramyxoviruses, like retroviruses, possess a class I membrane fusion mechanism, and there have been major recent advances in the understanding of the structural requirements and mechanisms involved in the ... involved in the fusion process mediated by these viruses (reviewed in [19,5355]) The present model of class I membrane fusion describes the formation of a trimer -of- hairpins structure whose oligomeric...
  • 15
  • 387
  • 0
báo cáo hóa học:" Inhibition of Henipavirus fusion and infection by heptad-derived peptides of the Nipah virus fusion glycoprotein" doc

báo cáo hóa học:" Inhibition of Henipavirus fusion and infection by heptad-derived peptides of the Nipah virus fusion glycoprotein" doc

Ngày tải lên : 20/06/2014, 04:20
... (HR-2) of the NiV F glycoprotein, was chosen for synthesis: KVDISSQISSMNQSLQQSKDYIKEAQRLLDTVNPSL (NiV FC2) A scrambled version of the 36-amino-acid peptide was also synthesized for use as a negative ... Paramyxoviruses, like retroviruses, possess a class I membrane fusion mechanism, and there have been major recent advances in the understanding of the structural requirements and mechanisms involved in the ... involved in the fusion process mediated by these viruses (reviewed in [19,5355]) The present model of class I membrane fusion describes the formation of a trimer -of- hairpins structure whose oligomeric...
  • 15
  • 266
  • 0
Báo cáo hóa học: " Research Article Localization of Directional Sound Sources Supported by A Priori Information of the Acoustic Environment" ppt

Báo cáo hóa học: " Research Article Localization of Directional Sound Sources Supported by A Priori Information of the Acoustic Environment" ppt

Ngày tải lên : 22/06/2014, 19:20
... slopes, caused by the periodicity of the signal The less periodic the signal is, the smaller the further peaks will be By assuming an aperiodic signal such as Dirac delta, peaks, that is, local ... results of several measurements The evaluation of location estimates was performed for both clean and noisy signals with a 10 dB SNR The results show that the summation of results of several measurements ... controls the number of previous measurements to be considered The value of S should be set according to the several parameters of application such as the maximum velocity of the moving speaker, the...
  • 14
  • 313
  • 0
Báo cáo khoa học: "Ectopic pancreatic-type malignancy presenting in a Meckel''''s diverticulum: a case report and review of the literature" docx

Báo cáo khoa học: "Ectopic pancreatic-type malignancy presenting in a Meckel''''s diverticulum: a case report and review of the literature" docx

Ngày tải lên : 09/08/2014, 04:21
... appendicectomy was carried out and an omental deposit was sampled for histological assessment Gross examination of the specimen revealed a 40 mm diameter tumour arising from the mucosal aspect of the bowel ... Meckel 's diverticulum serosal surface of the small bowel The resection margins and the adhered appendix were tumour-free A single omental deposit submitted separately was also involved by the tumour ... the tumour Histology of the tumour (Figure 3) showed that it was composed of scattered small glandular structures and also scattered bizarre single tumour cells The tumour cells expressed cytokeratin...
  • 5
  • 404
  • 0