management s assessment of the risk of material misstatement due to fraud ref para 17 a
Using ants as bioindicators in land management: simplifying assessment of ant community responses potx
... managers The study was conducted as part of a comprehensive assessment of biodiversity responses to SO2 emissions from a large copper and lead smelter at Mt Isa in the Table Key findings of a ... groundforaging ants: pitfall catches compared with quadrat counts in an Australian tropical savanna Australian Journal of Ecology, 16, 273 –279 Andersen, A. N (1993) Ants as indicators of restoration success ... ecological change associated with land use We suggest that research directed at making these groups accessible to land managers deserves higher priority than does further assessment of the relative...
- 16
- 354
- 0
Báo cáo y học: "Association of PTPN22 1858 single-nucleotide polymorphism with rheumatoid arthritis in a German cohort: higher frequency of the risk allele in male compared to female patients" potx
... thymic selection or decreased activity of regulatory T cells The aim of this study was to analyze the association of the 1858C/T SNP with RA in a sample set comprising 390 German white RA cases and ... contributions MP designed the study, oversaw all aspects of the laboratory work, analyzed the data and prepared the manuscript SK, SA, MW and CB participated in the collection of clinical data and the ... positive The median age at onset of RA was 47.0 years (interquartile range 37 to 59 years), the median disease duration was 12.5 years (interquartile range to 22 years) and 76.1% of the RA patients...
- 7
- 420
- 0
Girsanov’s theorem and the risk-neutral measure
... change the probability measure, means change but variances not Martingales may be destroyed or created Volatilities, quadratic variations and cross variations are unaffected Check: e e dB dB ... T is normal with mean zero and variance P mean T and variance T e T Under IP , B T is normal with Means change, variances don’t When we use the Girsanov Theorem to change the probability ... variable, then f IEZ = IE Z T X : To see this, consider first the case X = 1A , where A F We have Z Z f f IEX = IP A = Z T dIP = Z T 1A dIP = IE Z T X : A Now use Williams’ “standard...
- 8
- 541
- 0
WORKSHOP ON THE PREVENTION OF WATER POLLUTION DUE TO PIPELINE ACCIDENTS pot
... several methods in informative guidance as examples only No standard calibrates any of the suggested methods i.e sets a tolerable risk level This is up to the end user organizations 4 Pipeline ... for a safety instrumented function Control Room Plant Area High Pressure Sensor Mechanical Relief Valve to Flare Gas ESD Valve Separator Well Fluids Operator Interface Shutdown System Logic Solver ... room) Data channels for business WAN application (e.g facility management, GIS-data warehouse, e-mail, etc.) U N Functional Design Criteria for the SCADA System a) Process requirements prevent...
- 30
- 481
- 0
.About the pagination of this eBook Due to the unique page numbering scheme of this book, the pdf
... pictures from magazines and cut or tear them into small scraps according to color Make a separate pile of paper scraps for each color of the rainbow Check the rainbow image at the bottom of this page ... “Bathers at Asnières,” 1884, oil on canvas by Georges Seurat, © National Gallery Collection by kind permission of the Trustees of the National Gallery, London Page 41: Photo: Corbis; The Chess ... between variant shades of the same color Collect materials to use in the “cave painting” activity Rainbow Collage Have on hand colored construction paper, wrapping paper, or old magazine images that...
- 28
- 361
- 0
Báo cáo hóa học: " Changes in the criticality of Hopf bifurcations due to certain model reduction techniques in systems with multiple timescales" pdf
... on a time scale which is fast compared with other processes In these cases, a classic first step is to set the fast gating variables to their quasi-steady-state values, and thereby reduce the ... phase-plane analysis Concatenation of solutions of these two subsystems then allows an explanation of the genesis of, e.g., action potentials observed in the full model Identifying such a single separation ... neural activities such as bursting and spiking, and intracellular calcium signalling [1] In many of these models, the time scale separation becomes apparent in the form of a small dimensionless parameter...
- 22
- 370
- 0
báo cáo khoa học: " User’s perspectives of barriers and facilitators to implementing quality colonoscopy services in Canada: a study protocol" pps
... group of users representing a variety of expertises and contexts in Canada As such, 10 to 18 participants [68] for each group of users will be recruited across Canada through professional associations ... team consisting of one of the two principal investigators and a research associate to assess fitness of studies with the inclusion criteria Any discrepancies in study inclusion between the two ... colonoscopy services among different stakeholders (gastroenterologists, surgeons, family physicians, nurses, decision-informants, patients, healthcare services managers, healthcare systems administrators);...
- 9
- 337
- 0
báo cáo khoa học:" Nonmicrosurgical reconstruction of the auricle after traumatic amputation due to human bite" potx
... the anterior skin to the underlying vascular bed In addition, a postauricular flap was elevated The anterior skin was then sutured to the amputated stump of the ear and to the postauricular flap ... amputated stump of the ear and the skin of the helical rim was sutured to the elevated postauricular flap Two vicryl 3-0 sutures were used for fixation of the graft to the tissues of the mastoid ... reattachment of the ear as a compound graft usually leads to necrosis and total loss of the organ [1,4] Therefore, many techniques have been advocated in order to enhance the "take" of a replanted ear...
- 7
- 355
- 0
Báo cáo y học: "Aerosolized colistin for the treatment of nosocomial pneumonia due to multidrug-resistant Gram-negative bacteria in patients without cystic fibrosis" ppt
... antimicrobial agents was considered resistance Multidrug-resistant was defined as resistance of the isolate to five antipseudomonal classes of antimicrobial agents (i.e antipseudomonal penicillins, cephalosporins, ... press Levin AS, Barone AA, Penco J, Santos MV, Marinho IS, Arruda EA, Manrique EI, Costa SF: Intravenous colistin as therapy for nosocomial infections caused by multidrug-resistant Pseudomonas aeruginosa ... eight) strains Only in one case was a second strain isolated from the same culture specimen, and it was found to be methicillin-resistant Staphylococcus aureus Half of the isolated pathogens were sensitive...
- 7
- 338
- 0
Báo cáo y học: "Aerosolized colistin for the treatment of nosocomial pneumonia due to multidrug-resistant Gram-negative bacteria in patients without cystic fibrosi" pdf
... fibrosis: a pilot study J Cystic Fibrosis 2004, 3:23-28 Michalopoulos A, Kasiakou SK, Mastora Z, Rellos K, Kapaskelis AM, Falagas ME: Aerosolized colistin for the treatment of nosocomial pneumonia ... methicillinresistant Staphylococcus aureus) and colistin-resistant Gram-negative bacteria such as Serratia marcescens continue to be a threat However, in cases where only colistin-susceptible Gram-negative ... isolates are implicated, such as Acinetobacter spp or Ps aeruginosa as causing nosocomial pneumonia, nebulized therapy with colistin, or preferably with colistin sulphamethate, might be the ‘therapy...
- 2
- 255
- 0
Báo cáo y học: "Molecular basis of telaprevir resistance due to V36 and T54 mutations in the NS3-4A protease of the hepatitis C virus" pdf
... H-bonds and van der Waals interactions of the ligand with amino acids of the protease NS3- 4A The local connectivity of each residue was calculated as the number of its interactions using the Cytoscape ... PCACGSSDLYLVTRDADVIPARRRGDSTASLLSPRPLACLKGSSGGPVMCPSGHVAGIFRAAVCTRGVAKSLQFIPVETL PCTCGSSDLYLVTREADVLPARRRGDSTASLLSTRPLSCLKGSSGGPVMCPSGHVVGIFRAAVCTRGVAKALQFIPVETL PCTCGSSDLYLVTREADVLPARRRGDSTASLLSTRPLSCLKGSSGGPVMCPSGHVVGIFRAAVCTRGVAKALQFIPVETL ... PCTCGAVDLYLVTRNADVIPVRRKDDRRGALLSPRPLSTLKGSSGGPVLCPRGHAVGLFRAAVCARGVAKSIDFIPVESL PCTCGAVDLYLVTRNADVIPARRRGDRRGALLSPRPLSSLKGSSGGPVLCPRGHAVGIFRAAVCSRGVAKSIDFIPVESL PCTCGAVDLYLVTRNADVIPARRQGDRRGALLSPRPLSSLKGSSGGPVLCPRGHAVGIFRAAICTRGAAKSIDFIPIESL PCACGSSDLYLVTRDADVIPARRRGDSTASLLSPRPLACLKGSSGGPVMCPSGHVAGIFRAAVCTRGVAKSLQFIPVETL...
- 18
- 396
- 0
Prediction of service life due to the exposure of chlorides of reinforced concrete bridges near coastal areas in Vietnam = Dự báo tuổi thọ sử dụng của cầu bê tông cốt thép ven biển Việt Nam do xâm nhập clo (tóm tắt + toàn văn)
... diffusion coefficient determined from the test based on C1202 as in Eq 2.9 is basically suitable to results of Stanish used in Life 365 as well as those of Berke The thesis has synthesized studies ... methodology is based on a mathematical model of diffusion process to determine the corrosion initiation stage as well as a mathematical model of corrosion activation that causes by concrete cracking to ... Natutal Resources and Enviroment is the base to evaluate the influence of these causes and to establish a plan to cope with them 3.6.1.3 General evaluation of the influence of climate change to...
- 26
- 265
- 0
assessment of cadmium flows related to domestic activities and proposal of recovery solutions
... Selection of relevant substances, system boundaries, processes, and goods • Step Assessment of mass flows of goods • Step Assessment of substance concentrations in the goods • Step Calculation of substance ... analysis System analysis Selection of substance of concern 2.2.1 System analysis The tasks of “system analysis” are to identify the relevant substances, geographic boundaries and a reference year ... the system analysis The variables of an MFA system are the following: dMi(j)/dt: Stock change rate of substance i (or total mass) in each process Ai,j -s: Mass flow of substance i (or total mass)...
- 107
- 185
- 0
ECONOMIC EVALUATION OF HEALTH IMPACTS DUE TO ROAD TRAFFIC-RELATED AIR POLLUTION pptx
... expects to bear in case of a disease, such as loss of earnings, costs of averting behaviour or intangible costs As mentioned above, the advantage of the willingness -to- pay approach consists of its ... capita costs of the partial assessment approach are shown in Table 15 25 Table 15 Air pollution related health costs per capita based on the partial assessment approach (1996) France A ust ria To ... 2’900 cases in Austria, 11’000 cases in France and 1’600 cases in Switzerland The smallest number of road traffic attributable cases is obtained for respiratory hospital admissions (all ages) In...
- 29
- 407
- 0
Báo cáo Y học: Human bile salt-stimulated lipase has a high frequency of size variation due to a hypervariable region in exon 11 pot
... have shown that the molecular mass variants of BSSL found in milk results from a polymorphism in the BSSL gene This strongly suggests that BSSL variants described in other tissues, such as the ... expressing the high molecular mass variant together with a low molecular mass variant of BSSL in milk, carried two transcripts that hybridized to the BSSL-speci®c probe The sizes of these two transcripts ... betaine was added to each reaction to a ®nal concentration of M (Sigma, St Louis, MO, USA) A pair of primers, referred to as BSSL 12 and BSSL 14, was designed to cover the entire sequence of...
- 9
- 520
- 0
Báo cáo hóa học: " Effective harvesting, detection, and conversion of IR radiation due to quantum dots with built-in charge" docx
... each GaAs layer that separates QD layers These structures contain 20 stacks of InAs QD layers separated by GaAs with various dopant sheet densities providing zero, two, three, four, and six electrons ... for the inter-dot doping more complex The built-in-dot charge suppresses solely the capture processes of the carriers of the same sign as the dot charge Again, this suppression is strong and has ... temperatures of 500 ± 10°C InAs dots were grown on AlGaAs surfaces by deposition of approximately 2.1 monolayers of InAs During the normal growth of layers, the substrate was rotated at 30 RPM to...
- 13
- 416
- 0
Báo cáo hóa học: "Research Article Dynamic Model of Signal Fading due to Swaying Vegetation" ppt
... H Peltola, S Kellom¨ ki, H V¨ is¨ nen, and V.-P Ikonen, A a a a mechanistic model for assessing the risk of wind and snow damage to single trees and stands of Scots pine, Norway spruce, and birch,” ... modeling signal fading due to a single tree) Then, the parameter ranges are defined based on the agreements found between the measured and simulated first- and secondorder statistics Finally, realistic ... Ricean K-factors for different wind speeds are estimated from measurements In general, the new model has similar dynamical and statistical characteristics as those observed from measurement results...
- 11
- 309
- 0
Báo cáo vật lý: "LOSS OF STORAGE AREAS DUE TO FUTURE URBANIZATION AT UPPER RAMBAI RIVER AND ITS HYDROLOGICAL IMPACT ON RAMBAI VALLEY, PENANG, PENINSULAR MALAYSIA" pps
... be substantiated by the results of analysis on flood depths discussed later Point ‘e’ Loss of Storage Areas Due to Future Urbanization 72 showed the least changes in peak stages There is no significant ... Thus, careful examination has to be made on the transfer of impact downstream if the adjacent affected areas undergo certain mitigation measures Loss of Storage Areas Due to Future Urbanization ... than the peak flows in the other watersheds Storm recession period of the same watershed was characterized by a 2-day storm recession constant that was 40% to 100% greater than others This rapid...
- 21
- 455
- 0
Báo cáo sinh học: " Bayesian analysis of genetic change due to selection using Gibbs sampling" pps
... posterior distribution was as large as 1.075 The classical analysis gave an estimated value of ST 1.296 units, but no exact measure of variation can be associated to this estimate Approximate ... compute the sampling variance of the estimator of response, especially when variances used as priors have been estimated from the data at hand Using the Bayesian approach, a variety of designs could ... simulated sire models, and in analyses of litter size in pigs Application of the Bayesian approach to the analysis of selection experiments yields the marginal posterior distribution of response to...
- 28
- 320
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct mở máy động cơ lồng sóc các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008