hepatitis implicated donors and those found to have hepatitis b surface antigen or hepatitis c virus

The Nontraditional Path - Help for Non-Education Majors and Those Returning to the Field

The Nontraditional Path - Help for Non-Education Majors and Those Returning to the Field

Ngày tải lên : 25/10/2013, 16:20
... these applicants included lawyers, doctors, and < /b> a retired judge The city of Chicago has launched a Global Educators Outreach Program, which has provided teachers from India, Colombia, and < /b> the Philippines ... invaluable product We have < /b> been —National Center for on both sides of the table and < /b> we know how this Education Statisti cs works! Career-Switcher Success Stories There’s nothing quite like a success ... responsibilities Recruitment of foreign teachers, including sponsoring work visas, which are good for up The City and < /b> Coun ty of to < /b> six years San Francisco have < /b> recently hired 500 Recruitment of former...
  • 9
  • 396
  • 0
Báo cáo sinh học: " Reduced expression of Jak-1 and Tyk-2 proteins leads to interferon resistance in Hepatitis C virus " docx

Báo cáo sinh học: " Reduced expression of Jak-1 and Tyk-2 proteins leads to interferon resistance in Hepatitis C virus " docx

Ngày tải lên : 18/06/2014, 18:20
... laboratory as described earlier [38] Stable HCV replicon cell lines 5–15 and < /b> 9–13, replicating HCV subgenomic RNA were obtained from the laboratory of Ralf Bartenschlager, Germany Another HCV ... unlabelled IFN-α 2b for each dilution The specific binding of interferon to < /b> Huh-7 cells at a different concentration was recorded The amount of radioactivity specifically bound to < /b> the cell surface ... prototype Con1 sub-genomic replicon HCV RNA (Fig 1A) The HCV replicon is a dicistronic chimeric RNA which contains the gene encoding for neomycin phosphotransferase (conferring resistance to...
  • 13
  • 305
  • 0
Báo cáo y học: " Mutations in the E2-PePHD region of hepatitis C virus genotype-3a and correlation with response to interferon and ribavirin combination therapy in Pakistani patients" pptx

Báo cáo y học: " Mutations in the E2-PePHD region of hepatitis C virus genotype-3a and correlation with response to interferon and ribavirin combination therapy in Pakistani patients" pptx

Ngày tải lên : 11/08/2014, 21:21
... using CLC workbench software http:// www.clcbio.com Amino acid composition was calculated using MEGA version 4.1 The subject is very controversial as some of the investigators reported a correlation ... in Acknowledgements The authors thank all the subjects and < /b> doctors for their cooperation in the study Authors’ contributions SA and < /b> MI conceived of the study participated in its design and < /b> coordination ... publication on acceptance • Inclusion in PubMed, CAS, Scopus and < /b> Google Scholar • Research which is freely available for redistribution Submit your manuscript at www.biomedcentral.com/submit ...
  • 5
  • 254
  • 0
Báo cáo y học: "Prediction of prognostic biomarkers for Interferon-based therapy to Hepatitis C Virus patients: a metaanalysis of the NS5A protein in subtypes 1a, 1b, and 3a" doc

Báo cáo y học: "Prediction of prognostic biomarkers for Interferon-based therapy to Hepatitis C Virus patients: a metaanalysis of the NS5A protein in subtypes 1a, 1b, and 3a" doc

Ngày tải lên : 12/08/2014, 04:20
... called class association rules, to < /b> form an accurate classifier The accuracy of the rules is measured by their support (relative frequency of the body or head of the rule) and < /b> confidence (conditional ... search tool available from the HMMER package was also used to < /b> score the test sequences against a profile HMM and < /b> the prediction accuracy noted The threshold genetic distances scores, HMM scores, ... alignments and < /b> conserved positions for subtype 1b The resulting MSAs are the corner stone for subsequent analysis and < /b> for building the classifier Distance based trees for each genotype and < /b> region...
  • 9
  • 213
  • 0
Báo cáo khoa học: " Seroprevalence of Hepatitis B virus and Hepatitis C virus among blood donors in Nyala, South Dar Fur, Sudan" ppsx

Báo cáo khoa học: " Seroprevalence of Hepatitis B virus and Hepatitis C virus among blood donors in Nyala, South Dar Fur, Sudan" ppsx

Ngày tải lên : 12/08/2014, 04:20
... ELISA for both viruses (two for HBV and < /b> three for HCV), this could be due to < /b> short incubation period of the ICT employed in the study Characteristically short incubation tests not detect low ... incubation periods and < /b> multiple antigens All over it is clear that antibody to < /b> hepatitis < /b> B surface antigen (anti HBs) could not be detected at early stage of HBV infection i.e before three to < /b> ... relating to < /b> sexual activity is confidential or taboo It should be noted that other unknown or unstudied risk factors like circumcision, public nail clipping and < /b> any other cultural behavior that include...
  • 4
  • 436
  • 0
Báo cáo y học: " Seropositivity of Hepatitis B virus and Hepatitis C virus dual Infection among blood donors in Nyala Teaching Hospital" pot

Báo cáo y học: " Seropositivity of Hepatitis B virus and Hepatitis C virus dual Infection among blood donors in Nyala Teaching Hospital" pot

Ngày tải lên : 12/08/2014, 04:21
... study on the clinical and < /b> virological characteristics among patients with single occult hepatitis < /b> B virus (HBV), single occult hepatitis < /b> C virus (HCV) and < /b> occult HBV and < /b> HCV dual infection Journal ... meta-analysis of case control studies on the combined effect of hepatitis < /b> B and < /b> C virus infections in causing hepatocellular carcinoma in China British Journal of Cancer 2005, 92:607-612 Crespo J, Lozano ... infection of HBV and < /b> HCV was never detected in Northern Sudan[15] So dual infection of HBV and < /b> HCV is uncommon in Nyala and < /b> may be in the large Sudan due to < /b> the endemic level of both viruses Conclusion...
  • 2
  • 348
  • 0
Báo cáo khoa học: "PreS1 epitope recognition in newborns after vaccination with the third-generation Sci-B-Vac™ vaccine and their relation to the antibody response to hepatitis B surface antigen" potx

Báo cáo khoa học: "PreS1 epitope recognition in newborns after vaccination with the third-generation Sci-B-Vac™ vaccine and their relation to the antibody response to hepatitis B surface antigen" potx

Ngày tải lên : 12/08/2014, 04:21
... ovary (rCHO) cell-derived Sci -B- Vac™ vaccine, (SciGen Ltd, Singapore, earlier referred to < /b> as Bio-Hep -B vaccine, Bio-Technology General Corporation) [19] The vaccine was purified from the culture ... such vaccine (BioHep B/ Sci -B- Vac™, also known as Hepimmune) have < /b> repeatedly confirmed the excellent immunogenicity measured as antibody to < /b> hepatitis < /b> B surface antigen (antiHBs) production and < /b> safety ... hepatitis < /b> B surface antigen; Anti-HBc: antibody to < /b> hepatitis < /b> B core antigen; Anti-HBs: antibody to < /b> hepatitis < /b> B surface antigen; ALT: alanine aminotransferase; OD: optical density; N: normal; S: sample...
  • 6
  • 283
  • 0
Báo cáo y học: "Molecular basis of telaprevir resistance due to V36 and T54 mutations in the NS3-4A protease of the hepatitis C virus" pdf

Báo cáo y học: "Molecular basis of telaprevir resistance due to V36 and T54 mutations in the NS3-4A protease of the hepatitis C virus" pdf

Ngày tải lên : 14/08/2014, 08:20
... : Welsch et al R16.15 T54A/S β3 β1 HCV_1a HCV_ 1b HCV_ 1c HCV_2a HCV_ 2b HCV_ 2c HCV_2k HCV_3a HCV_ 3b HCV_3k HCV_4a HCV_5a HCV_6a HCV_ 6b HCV_ 6c HCV_6g HCV_6h HCV_6k Volume 9, Issue 1, Article R16 ... HCV_1a HCV_ 1b HCV_ 1c HCV_2a HCV_ 2b HCV_ 2c HCV_2k HCV_3a HCV_ 3b HCV_3k HCV_4a HCV_5a HCV_6a HCV_ 6b HCV_ 6c HCV_6g HCV_6h HCV_6k : : : : : : : : : : : : : : : : : : 140 100 * 120 * * 160 * PCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVDFIPVENL ... indicated as C , C and < /b> C Protein backbone changes are depicted in black The contribution of F43 to < /b> the hydrophobic cavity conformation and < /b> the cyclopropyl binding pocket is illustrated by means...
  • 18
  • 396
  • 0
Safe Blood Transfusion- Screening for Hepatitis B and Hepatitis C Virus Infections in Potential Blood Donors in Rural Southeast Asia

Safe Blood Transfusion- Screening for Hepatitis B and Hepatitis C Virus Infections in Potential Blood Donors in Rural Southeast Asia

Ngày tải lên : 03/03/2015, 21:05
... Antibodies to < /b> Hepatitis < /b> B surface antigen Anti-HCV Antibodies to < /b> Hepatitis < /b> C BCP Basal Core Promoter cccDNA Covalently Closed Circular DNA CHC Chronic hepatitis < /b> C CMIA Chemiluminescent Microparticle ... Hepatitis < /b> B core antigen Anti-HBc IgG IgG antibody to < /b> hepatitis < /b> B core antigen Anti-HBc IgM IgM antibody to < /b> hepatitis < /b> B core antigen Anti-HBe Antibodies to < /b> Hepatitis < /b> B envelope antigen Anti-HBs Antibodies ... Entecavir FDA Food and < /b> Drug Administration HBcAg Hepatitis < /b> B Core Antigen HBeAg Hepatitis < /b> B Envelope antigen HBIG Hepatitis < /b> B Immunoglobulin HBsAg Hepatitis < /b> B surface antigen HBV Hepatitis < /b> B virus...
  • 64
  • 464
  • 0
Báo cáo y học: "Hepatitis C Virus (HCV) Infection and Hepatic Steatosis"

Báo cáo y học: "Hepatitis C Virus (HCV) Infection and Hepatic Steatosis"

Ngày tải lên : 02/11/2012, 09:51
... therapies for insulin resistance and < /b> steatosis-induced fibrosis in chronic hepatitis < /b> C In order to < /b> devise specific therapies for HCV-induced steatosis, further investigation needs to < /b> be done on the complex ... patients with chronic hepatitis < /b> C J Clin Pathol 2001;54:461-5 23 Rubbia-Brandt L, Quadri R, Abid K, et al Hepatocyte steatosis is a cytopathic effect of hepatitis < /b> C virus genotype J Hepatol 2000;33:106-15 ... non-alcoholic steatohepatitis and < /b> certainly in our patients with HCV and < /b> metabolic steatosis HCV-Induced Steatosis The presence of steatosis on liver biopsy in patients with hepatitis < /b> C is more...
  • 4
  • 438
  • 0
Báo cáo y học: "Hepatitis B Virus (HBV) and Hepatitis C Virus (HCV) Dual Infection"

Báo cáo y học: "Hepatitis B Virus (HBV) and Hepatitis C Virus (HCV) Dual Infection"

Ngày tải lên : 02/11/2012, 09:51
... no conflict of interest exists References 10 11 12 13 14 Table Coinfection with HBV and < /b> HCV and < /b> risk of HCC Variables Case number HCC case No HBV(-)HCV(-) HBV(+)HCV(-) HBV(-)HCV(+) HBV(+)HCV(+) ... effective for HCV/HBV-coinfected patients in eradicating HCV infection and < /b> might promote HBV seroclearance Int J Med Sci 2006, 60 Dual Infection of HBV and < /b> HCV and < /b> hepatocellular carcinoma (HCC) ... (HCC) Conflict of interest HBV and < /b> HCV infections are confirmed causes of HCC What’s the combined effect of HBV and < /b> HCV coinfection on HCC? Accumulated epidemiological data suggested that coinfection...
  • 6
  • 621
  • 1
Báo cáo y học: "Hepatitis C Virus Serologic and Virologic Tests and Clinical Diagnosis of HCVRelated Liver Disease"

Báo cáo y học: "Hepatitis C Virus Serologic and Virologic Tests and Clinical Diagnosis of HCVRelated Liver Disease"

Ngày tải lên : 02/11/2012, 09:56
... Assay Amplicor HCV Monitor® v2.0 Cobas® Amplicor HCV Monitor v2.0 LCx HCV RNA Quantitative Assay Versant® HCV RNA 3.0 Assay Cobas® TaqMan HCV Test Abbott RealTime Roche Molecular Systems Abbott Diagnostic ... PCR : Amplicor HCV Monitor® v2.0 and < /b> its semi-automated version Cobas® Amplicor HCV Monitor® v2.0 (Roche Molecular Systems), and < /b> LCx® HCV RNA Quantitative Assay (Abbott Diagnostic); one is based ... Chronic hepatitis < /b> C In patients with clinical or biological signs of chronic liver disease, chronic hepatitis < /b> C is certain when both antiHCV antibodies and < /b> HCV RNA (sought for with a sensitive technique,...
  • 6
  • 612
  • 0
Tài liệu Báo cáo khoa học: Template requirements and binding of hepatitis C virus NS5B polymerase during in vitro RNA synthesis from the 3¢-end of virus minus-strand RNA docx

Tài liệu Báo cáo khoa học: Template requirements and binding of hepatitis C virus NS5B polymerase during in vitro RNA synthesis from the 3¢-end of virus minus-strand RNA docx

Ngày tải lên : 20/02/2014, 01:20
... CCCCTGATGGGGGCGTATTTCCACCATGAATCACTCCCC GTGATTCATGGTGGAAATACGCCCCCATCAGGGGGCTGG TTTTGCGGCCGCGCCAGCCCCCTGATGGGGGCGCAGCCTCCAGGA CCCCCCCTCCCGGGAGAGCCATAGTGGTCTGCGGAACCGGTTTT AAAAACCGGTTCCGCAGACCACTATGGCTCTCCCGGGAGGGGGGG TCCTGGAGGCTGCGCCCCCATCAGGGGGCTGGCGCGGCCGCAAAA ... GCCAGCCCCCTGATGGGGGCGA TAATACGACTCACTATAGGGTGCACGGTCTACGAGACCT GCCAGACACTCCACCATGAATCACTCCCCTGTGAGGAACTACTGTCTTCACG TAATACGACTCACTATAGGGTGCACGGTCTACGAGACCT TTTGCGGCCGCGCCAGCCCCCTGATGGGGGCGACACTCCACCATGAATTCT ... TTTGCGGCCGCGCCAGCCCCCTGATGGGGGCGACACTCCACCATGAATTCT AGCCATGGTTT AAACCATGGCTAGAATTCATGGTGGAGTGTCGCCCCCATCAGGGGGCTGGC GCGGCCGCAAA GGCTGCACGACACTCCGCCATGGCTAGACGCTTTC CGTCTAGCCATGGCGGAGTGTCGTGCAGCCTCCAGG CCCCTGATGGGGGCGTATTTCCACCATGAATCACTCCCC...
  • 15
  • 597
  • 0
Báo cáo khoa học: Binding of the volatile general anesthetics halothane and isoflurane to a mammalian b-barrel protein doc

Báo cáo khoa học: Binding of the volatile general anesthetics halothane and isoflurane to a mammalian b-barrel protein doc

Ngày tải lên : 07/03/2014, 16:20
... C, Bertoli E & Pelosi P (1999) Porcine odorant-binding protein: Structural stability and < /b> ligand affinities measured by Fourier-transform infrared spectroscopy and < /b> fluorescence spectroscopy Biochim ... indicate destabilization (faster exchange) Acknowledgements Work supported by NIH GM55876 (JSJ and < /b> RGE), and < /b> by MIUR, Progetto Giovani Ricercatori, Ricercatori Singoli (RR and < /b> SG) References Spinelli ... titration calorimetry Isothermal titration calorimetry was performed using a MicroCal VP-ITC titration microcalorimeter (Northampton, MA, USA) at 20 C Porcine odorant binding protein at a concentration...
  • 9
  • 421
  • 0
Báo cáo khoa học: Recent contributions of in vitro models to our understanding of hepatitis C virus life cycle pdf

Báo cáo khoa học: Recent contributions of in vitro models to our understanding of hepatitis C virus life cycle pdf

Ngày tải lên : 16/03/2014, 05:20
... receptor candidates scavenger receptor class B type (SR -B1 ) and < /b> CD81 have < /b> been evaluated in Huh7 cells Whereas CD81 has been shown to < /b> be directly involved in the entry process, SR -B1 influenced ... structural, biophysical and < /b> antigenic properties of HCV-like particles have < /b> been characterized and < /b> might partly mimic those < /b> of native HCV particles and < /b> be close to < /b> pseudotyped particles described later, ... much effort has been employed to < /b> confirm results obtained using the HCVpp model For example, HCV entry into target cells is mediated by E2 [10], and < /b> CD81 has been shown to < /b> be critical for HCVcc...
  • 14
  • 532
  • 0
Báo cáo sinh học: " Hepatitis B virus and hepatitis C virus in pregnant Sudanese women" pot

Báo cáo sinh học: " Hepatitis B virus and hepatitis C virus in pregnant Sudanese women" pot

Ngày tải lên : 18/06/2014, 18:20
... expected risk factors (parity, age, history of blood transfusion, dental manipulations, tattooing and < /b> circumcision) had been found < /b> to < /b> be associated with HBVsAg sero-positivity Due to < /b> kids constrains, ... Your research papers will be: available free of charge to < /b> the entire biomedical community peer reviewed and < /b> published immediately upon acceptance cited in PubMed and < /b> archived on PubMed Central yours ... Africa and < /b> Influence of maternal (HIV) co-infection on vertical transmission of HCV have < /b> been reported before [16,17] Thus, the geographical influence of high endemicity in neighboring sub-Saharan...
  • 3
  • 399
  • 0
Báo cáo sinh học: " The simultaneous presence and expression of human hepatitis C virus (HCV), human herpesvirus-6 (HHV-6), and human immunodeficiency virus-1 (HIV-1) in a single human T-cell" docx

Báo cáo sinh học: " The simultaneous presence and expression of human hepatitis C virus (HCV), human herpesvirus-6 (HHV-6), and human immunodeficiency virus-1 (HIV-1) in a single human T-cell" docx

Ngày tải lên : 18/06/2014, 18:20
... tag atc act c cat gat gca cgc tct acg aga c ctg tga gga act act gtc ttc acg cag cac tcg caa cca ccc tat cag cca gcn cac aaa ggn ata gga gg acb acy gcn cct tch cct ttc ccc aat ccc ccc ttt tct tta ... HHV-6A, HCV, and < /b> HIV Virus Primer Sequence (5' to < /b> 3') Reference HCV HCV HCV HCV HIV HIV HIV HHV-6 HHV-6 HCV 9.1 HCV 9.2 HCV 10.1 HCV 10.2 Con-1f1 Con-1r1 Con-1r2 U16-17F U16-17R gac act cca cca tag ... that CEM cultures could be co-infected by the combinations of two different viruses (cultures K2 and < /b> K6) As a control, we infected macrophages obtained from cord blood cells with HHV-6A (K3) or both...
  • 8
  • 410
  • 0
Báo cáo hóa học: " Hepatitis B virus and hepatitis C virus in pregnant Sudanese women" doc

Báo cáo hóa học: " Hepatitis B virus and hepatitis C virus in pregnant Sudanese women" doc

Ngày tải lên : 20/06/2014, 01:20
... expected risk factors (parity, age, history of blood transfusion, dental manipulations, tattooing and < /b> circumcision) had been found < /b> to < /b> be associated with HBVsAg sero-positivity Due to < /b> kids constrains, ... Your research papers will be: available free of charge to < /b> the entire biomedical community peer reviewed and < /b> published immediately upon acceptance cited in PubMed and < /b> archived on PubMed Central yours ... Africa and < /b> Influence of maternal (HIV) co-infection on vertical transmission of HCV have < /b> been reported before [16,17] Thus, the geographical influence of high endemicity in neighboring sub-Saharan...
  • 3
  • 353
  • 0
Báo cáo hóa học: " The simultaneous presence and expression of human hepatitis C virus (HCV), human herpesvirus-6 (HHV-6), and human immunodeficiency virus-1 (HIV-1) in a single human T-cell" pptx

Báo cáo hóa học: " The simultaneous presence and expression of human hepatitis C virus (HCV), human herpesvirus-6 (HHV-6), and human immunodeficiency virus-1 (HIV-1) in a single human T-cell" pptx

Ngày tải lên : 20/06/2014, 01:20
... tag atc act c cat gat gca cgc tct acg aga c ctg tga gga act act gtc ttc acg cag cac tcg caa cca ccc tat cag cca gcn cac aaa ggn ata gga gg acb acy gcn cct tch cct ttc ccc aat ccc ccc ttt tct tta ... HHV-6A, HCV, and < /b> HIV Virus Primer Sequence (5' to < /b> 3') Reference HCV HCV HCV HCV HIV HIV HIV HHV-6 HHV-6 HCV 9.1 HCV 9.2 HCV 10.1 HCV 10.2 Con-1f1 Con-1r1 Con-1r2 U16-17F U16-17R gac act cca cca tag ... that CEM cultures could be co-infected by the combinations of two different viruses (cultures K2 and < /b> K6) As a control, we infected macrophages obtained from cord blood cells with HHV-6A (K3) or both...
  • 8
  • 446
  • 0