had taken his father s advice he would not be out of work now
Chinh phục đề thi THPT Quốc gia môn Tiếng Anh - Tập 1
Ngày tải lên :
15/05/2016, 22:20
... án xác He denied having been there at the time Question … had taken his father s advice, he would not be out of work now Đề bài: He didn’t take his father s advice That s why he is out of work ... recently found at the bases of the teeth in some species A Although sharks were B Despite sharks being C In spite of sharks are D Nevertheless, sharks Question 16: When she her mistake, she apologized ... means the same as the sentence printed before it Write your answers on your answer sheet Question 1: “I was not there at the time,” he said He denied Question 2: He didn’t take his father s advice...
- 93
- 2.7K
- 1
Testing Costs and Testing Capacity According to the REACH Requirements – Results of a Survey of Independent and Corporate GLP Laboratories in the EU and Switzerland potx
Ngày tải lên :
23/03/2014, 05:22
... requirements for the notification of new chemical substances The notification of new chemical substances in the EU requires specific test data to be provided by the notifier of the new substance The testing ... dated 29 October 2003 [4] © 2007 Institute of Business Administration September 2007 97 ISSN 1613-9615 Journal of Business Chemistry www.businesschemistry.org Fleischer on the prices they would charge ... during the tests, and intermediate results; because they often determine the effort and inputs for single tests; and as such the costs/prices of these That is the exact actual costs/prices could...
- 19
- 493
- 1
Báo cáo y học: "Background: Percutaneous tracheostomy (PT) has gained an increasing acceptance as an alternative to the conventional surgical tracheostomy (ST). In experienced hands, and with proper patient selection, it is safe, easy and quick." docx
Ngày tải lên :
12/08/2014, 18:20
... there are still reservations on its use in this age group due to the marked elasticity of the tracheal tissue Griggs’ technique The distinctive feature of this technique is the use of a pair of modified ... [4] described the point of entry to be subcricoidal; however, this was found to be too high, with a risk of subglottic stenosis [29–31] Therefore, the preferred site of entry is now between the ... tracheal stenosis of at least 10% in about 40% of their follow-up patients about one-quarter that for the surgical route [36,38], which implies less stress to the patient and better use of available...
- 6
- 342
- 0
Báo cáo y học: " Early alterations of the innate and adaptive immune statuses in sepsis according to the type of underlying infection" docx
Ngày tải lên :
13/08/2014, 20:22
... Expression of TLRs was not assessed in the present study Instead activation of monocytes was assessed by the expression of HLA-DR on the cell surface; decrease of CD14/HLA-DR co-expression is considered ... sepsis (P = 0.050 after adjustment for multiple comparisons) Table 2: Results of analysis of monocytes and of subsets of lymphocytes of blood samples of nine patients with sepsis processed before ... with the administration of agents modulating the immune response of the host Results of these trials were controversial It has been hypothesized that part of this controversy is due to the enrolment...
- 12
- 400
- 0
Automatic patent classification according to the TRIZ inventive principles
Ngày tải lên :
11/09/2015, 14:36
... causes the pod to burst at its weakest point and the top pops out with the seeds A similar process was used to shell cedar nuts, shell sunflower seeds and break sugar crystals into powers This ... Multi-class Settings Many classification tasks address more than two classes: C = {c1, c2,… ck} where k>2 Each document is assigned to one of the k classes In this case, a multi-class setting is needed ... test set with the other k-1 subsets as the training set in turn Then the measures across all k 29 trials are averaged as the overall evaluation for the classifiers This approach makes use of the...
- 179
- 315
- 0
English to the max 1 200 questions that will maximize your english power
Ngày tải lên :
28/07/2016, 16:11
... sentences c Dashes can be used to set off a parenthetical element, for emphasis (Place another em dash after the word senior.) a The possessive Kim s requires an apostrophe e This sentence is ... number with its subject, one 109 b This is a complete sentence; the others are fragments 110 a The comparison between the speaker s and his or her sister s taste for fish is clearest in this sentence ... are incorrect because brang is not the past tense of bring 132 a This choice is the only one that uses the proper form of possessive pronouns 133 c This choice is best because it is the only one...
- 450
- 1.2K
- 0
Write to the point how to communicate in business with style purpose
Ngày tải lên :
23/11/2016, 21:39
... supervisors, or just plain too exhausted or not in the mood to write even the shortest of sentences So what can we about this frustrating dilemma? Sometimes doing nothing is the best course of ... Writing is usually never easy and almost always a challenge and stressful So maybe the first step to better business writing is to try to eliminate the stress This document is created with the unregistered ... reader 's shoes works perfectly well here An additional source of stress is trying to figure out how best to express our thoughts to our various readers, whether they be coworkers anywhere in the world...
- 403
- 3.9K
- 0
Báo cáo khoa học: The signature amidase from Sulfolobus solfataricus belongs to the CX3C subgroup of enzymes cleaving both amides and nitriles Ser195 and Cys145 are predicted to be the active site nucleophiles pot
Ngày tải lên :
07/03/2014, 21:20
... described here strongly suggests that the Ser171–cisSer195–Lys96 catalytic triad, similarly to other members of this family, forms the active site of this enzyme Here we also suggest that a second ... activity of the mutant SsAH-K96R on aliphatic amides and nitriles strengthens this hypothesis Another line of evidence comes from the results of the inhibition studies shown in Fig Phenylmethanesulfonyl ... PHMDATVVSRILDEAGEIVAKTTCEDLCFSGGSHTSYPWPVLNPRNPEYMAGGSSSGSAV 177 PSEDATVVKRLLAAGATVVGKSVCEDLCFSGASFTSASGAVKNPWDLARNAGGSSSGSAV 177 PSEDATVVKRLLAAGATVIGKSVCEDLCFSGASFTSATGAVKNPWDLTRNAGGSSSGSAV 177 PSRDATVVTRLLAAGATVAGKAVCEDLCFSGSSFTPASGPVRNPWDPQREAGGSSGGSAA...
- 9
- 478
- 0
Physics of the Future: How Science Will Shape Human Destiny and Our Daily Lives by the Year 2100
Ngày tải lên :
14/03/2014, 08:49
... Katherine Ramsland, forensic scientist Lisa Randall, professor of theoretical physics, Harvard University, author of Warped Passages Sir Martin Rees, professor of cosmology and astrophysics, ... up new ways to understand the universe In Physics of the Impossible, I discussed how the latest discoveries in physics may eventually make possible even the most imaginative schemes of science ... images and messages instantly across the continents, they would view this as sorcery But this is just the beginning Science is not static Science is exploding exponentially all around us If you...
- 1.1K
- 2.2K
- 0
Báo cáo khoa học: Recruitment of coregulator complexes to the b-globin gene locus by TFII-I and upstream stimulatory factor doc
Ngày tải lên :
23/03/2014, 07:20
... induced by hemin, which has been shown to increase the expression of e- and c-globin gene expression in these cells However, the effect of hemin on globin gene expression in these cells is relatively ... render the b-globin promoter accessible or inaccessible to the transcription complex USF recruits the histone acetyltransferase p300 to the b-globin promoter and this activity increases the accessibility ... Nevertheless, it is possible that the PRC complex represses globin gene expression in a differentiation and developmental stage-specific manner This is consistent with previous findings demonstrating...
- 9
- 312
- 0
Báo cáo khoa học: "Escherichia coli O157:H7 adherence to HEp-2 cells is implicated with curli expression and outer membrane integrity" potx
Ngày tải lên :
07/08/2014, 17:22
... pO157-encoded msbB2 gene could complement loss of msbB1 function in the single msbB1 mutant [15] Either single msbB1 or msbB2 mutant showed the same hexa-acyl lipid A structure, whereas the double msbB ... in adherence to host epithelial cells The CR- variants of CR+ strain 4304 were obtained from time repeated passages of the strain in LB broth and subsequent spreading of the culture aliquots onto ... EMEM- was added to each chamber and the co-culture system was incubated further for another h Then, the tissue culture slides were washed times with PBS, fixed with 70% methanol, and stained...
- 6
- 241
- 0
olutions to the reflection equation a bijection between lattice configurations and marked shifted tableaux
Ngày tải lên :
22/12/2014, 16:55
... L Therefore, = = the values of the vertical edges label the basis vectors in Vj , while the values of the horizontal edges label the basis vectors in Vi The mapping which gives us this labelling ... allowed vertices of the six vertex model 3.9 The Six Vertex Model This section is based upon unpublished results, [10] The osculating and vicious walkers are actually special cases of another model, ... wherein many models in statistical physics have been used to prove combinatorial results, and vice versa One of the first major results relating the two fields was Greg Kuperberg s proof of the...
- 69
- 331
- 0
Teachers' difficulties in teaching English listening skills to the 11th -grade at Daimo High school, Hanoi and some suggested solutions = Khó khăn của giáo viên
Ngày tải lên :
30/03/2015, 14:30
... How students discuss their listening comprehension problems Chart illustrates the frequency of discussions by students when they had listening problems Half of the students (50%) discussed their ... teachers‟ assistance Only 16% of the students discussed listening comprehension problems with their teachers Besides, their English teachers considered the result of the final exam as the most important ... -3- help their students overcome their listening comprehension problems The results of this study may also be useful for those who are interested in this field Design of the study The study is...
- 61
- 1.1K
- 2
Teaching english vocabulary to the first year students at nghe an trading and tourism vocational college
Ngày tải lên :
20/07/2015, 12:58
... the unknown term, unless a quest ion about it is raised by the students This does not necessarily mean that the teacher is not doing his duty, as it is not always necessary to understand the meaning ... least a general understanding of the passage The usual procedure would be to ask questions to establish the general sense of the passage first and then continue with more specific questions about ... afterwards 2.2 Teachers' beliefs 2.2.1 Teachers’ beliefs Because investigating teachers’ perceptions about teaching vocabulary is set 23 under the umbrella of the area of teacher s beliefs It is thus...
- 78
- 509
- 0
Teaching english vocabulary to the first year students at nghe an trading and tourism vocational college
Ngày tải lên :
20/07/2015, 14:49
... the unknown term, unless a quest ion about it is raised by the students This does not necessarily mean that the teacher is not doing his duty, as it is not always necessary to understand the meaning ... least a general understanding of the passage The usual procedure would be to ask questions to establish the general sense of the passage first and then continue with more specific questions about ... afterwards 2.2 Teachers' beliefs 2.2.1 Teachers’ beliefs Because investigating teachers’ perceptions about teaching vocabulary is set 25 under the umbrella of the area of teacher s beliefs It is thus...
- 79
- 410
- 1
The Innovators How A Group Of Hackers, Geniuses, And Geeks Created The Digital Revolution
Ngày tải lên :
05/11/2016, 17:31
... book is copyright under the Berne Convention No reproduction without permission All rights reserved The right of Walter Isaacson to be identified as the author of this work has been asserted ... http://freebookss.com electromechanical computer 1935 Tommy Flowers pioneers use of vacuum tubes as on-off switches in circuits 1937 http://freebookss.com Alan Turing publishes “On Computable Numbers,” describing ... were a lot of fascinating people involved, some ingenious and a few even geniuses This is the story of these pioneers, hackers, inventors, and entrepreneurs—who they were, how their minds worked,...
- 864
- 439
- 0
A Thesis Submitted to the Graduate Facultyof theNorth Dakota State Universityof Agriculture and Applied Science
Ngày tải lên :
12/12/2016, 20:40
... presents the results of the economic assessment of ten wetland case studies Chapter includes conclusions, implications, and recommendations and identifies the need for further study of wetlands ... Board of Water and Soil Resources, St Paul) a Objective The objective of this study was to assess the economic efficiency of Minnesota s WCA mitigation policy from society s perspective It was assumed ... was enacted to help manage the state s wetlands Terms such as attributes, benefits, characteristics, features, functions, outcomes, outputs, services, social value, and value are used throughout...
- 154
- 286
- 0
Báo cáo Y học: The SK-N-MC cell line expresses an orexin binding site different from recombinant orexin 1-type receptor pptx
Ngày tải lên :
08/03/2014, 22:20
... editing process which will be further investigated ACKNOWLEDGEMENTS The financial support of the Deutsche Forschungsgemeinschaft (Be 1264-3/1) is kindly acknowledged We further acknowledge the skilled ... important sequence motif in the C-terminus of the peptides, that might play an essential role in binding of the peptides to this receptor This is in accordance with the recently published three-dimensional ... Fig shows that all other amino acids are 100% identical to the published sequence [1] Analysis of the human genomic DNA revealed that adenosine is present at this position, which leads to an isoleucine...
- 8
- 423
- 0