flesh but by the soul and that the corruption contracted from sin is not sin but sin s punishment
Báo cáo hóa học: " Comparison of p53 and the PDZ domain containing protein MAGI-3 regulation by the E6 protein from high-risk human papillomaviruses" pdf
... in the presence and absence of the various E 6s and therefore comparisons between the various E 6s could be made This Western blot suggested that some variants may be more effective than others ... co-transfected with plasmids expressing p53 and a p53responsive p21 luciferase reporter plasmid Cell lysates were then prepared for the measurement of luciferase activity, and later assessed by Western ... blot analysis to determine p53 and E6-GFP levels The result of the Western blot can be seen in Figure 2A, which shows that all of the constructs expressing the various E6-GFP fusion proteins mediated...
- 9
- 383
- 0
Báo cáo lâm nghiệp: "Discrimination of coated carbide tools wear by the features extracted from parallel force and noise level" potx
... measurement edge, parallel force and noise level were measured Then, cutting test was continued on another new disk by replacing the old disk with the new disk Testing was stopped up to ten pass ... amplifier and a GP-IB board was used to record and to display the force during cutting on the personal computer RESULTS AND DISCUSSION 3.1 Parallel force and noise characteristics of the coated ... cutting speeds performed For this discussion, the parallel force and noise level behaviors of the TiN/AlN coated tool are provided as presented in Figures and These figures give an indication that the...
- 6
- 310
- 0
Báo cáo y học: " Modulation of microtubule assembly by the HIV-1 Tat protein is strongly dependent on zinc binding to Tat" pptx
... apoptosis and the progression to AIDS [14,16] However, in these studies, the zinc binding status of Tat was not checked, despite the evidence that Tat is able to bind zinc ions through its cysteine-rich ... (1MEPVDPRLEPWKHPGSQPKTACTTCYCKKCCFHCQV CFTTKAL GISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQPRGDPT GPKE86) was chemically synthesized and purified as described previously [27] Tat-RhB was synthesized using the same strategy ... was synthesized by solid-phase chemistry and was shown to be highly pure and biologically active [27] Using fluorescence correlation spectroscopy (FCS) and time-resolved fluorescence spectroscopy,...
- 13
- 357
- 0
Báo cáo khoa học: b-Amyloid protein oligomers induced by metal ions and acid pH are distinct from those generated by slow spontaneous ageing at neutral pH docx
... form SDS-resistant oligomers, which can be measured by SDS-gel electrophoresis [11,24,26] However, it is unclear whether the formation of SDS-resistant species accurately reflects the overall state ... aggregates (Fig 9) The first mechanism is rapid, generates unstable aggregates, is stimulated at pH 5.0 or by Cu2+ and Zn2+ The second mechanism is slow (occurs over several days), generates stable ... Student s two-tailed t-test in the sensitivity of specific Ab oligomers to disassembly by SDS Interestingly, the results of the PAGE experiments suggested that some of the Ab was aggregated, even after...
- 12
- 439
- 0
Báo cáo y học: "The MHC2TA -168AG gene polymorphism is not associated with rheumatoid arthritis in Austrian patients" pps
... Germany) The ELISA was performed according to the manufacturer 's instructions Statistical analysis was performed using SPSS for Windows, release 11.0.1 (SPSS Inc., Chicago, IL, USA) Metric values were ... MHC2TA genotypes were determined by a TaqMan™ fluorogenic 5'-nuclease assay (Applied Biosystems, Vienna, Austria) using Applera 's Assays -by- Design custom service The sequences of the primers and probes ... analysis The criterion for statistical significance was P < 0.05 Results MHC2TA genotypes were successfully determined in 362 patients and in 351 controls Genotype distribution did not deviate from...
- 5
- 393
- 0
By the Light of the SoulMary Eleanor Wilkins-Freeman..By the Light of the Soul A Novel By Mary E. Wilkins Freeman Author of “The Debtor” “The Portion of Labor” “Jerome” “A New England Nun” Etc. etc.1907To Harriet and Carolyn Alden..By the Light o pptx
... with resentment Then Miss Ida Slome passed by, and Wollaston Lee was clinging to her arm, pressing as closely to her side as he dared Miss Slome saw Maria, and spoke in her sweet, crisp tone ... gazing straight at Miss Slome, Miss Ida Slome, who was the schoolteacher, and his young face wore an expression of devotion Maria s By the Light of the Soul eyes followed his; she did not dream ... imagination She 20 By the Light of the Soul thought to herself that her mother might never put on those clothes again She kissed the folds of her mother s dress passionately, and emerged from the closet,...
- 488
- 398
- 0
Báo cáo khoa học: A strategy for the generation of specific human antibodies by directed evolution and phage display An example of a single-chain antibody fragment that neutralizes a major component of scorpion venom docx
... Interestingly, clones selected from the standard procedure had fewer changes (usually one), whereas using the stringent strategy, the selected clones showed 2–6 changes Clone 6009F was selected and ... nucleotide sequences were compared with the databases using the BLAST algorithm The best scores corresponded to human immunoglobulins The nucleotide sequences were also compared with the IMGT databases ... affinities in the nanomolar range and lower [18–20] This result was expected, because the library is nonimmune, is of medium size and it is now known that higher affinity binders can be selected from...
- 11
- 679
- 0
To Live To See the Great Day That Dawn - :Preventing Suicide by American Indian and Alaska Native ppt
... increases an individual s risk of suicide.47 The speculation is that these less assimilated individuals are less prepared to handle the stress that may be imposed by their new lifestyle.48 Conversely, ... Marine troops, prisons, and religious sects, to name a few However, teenagers and young adults appear most at risk.88, 89 This is not surprising given the characteristics of impulsiveness, difficulty ... those of the author and not necessarily reflect the views, opinions, or policies of SAMHSA or HHS The listing of non-Federal resources in this document is not comprehensive and inclusion does not...
- 184
- 317
- 0
Báo cáo khoa học: Tracking interactions that stabilize the dimer structure of starch phosphorylase from Corynebacterium callunae Roles of Arg234 and Arg242 revealed by sequence analysis and site-directed mutagenesis doc
... almost identical affinities in wildtype StP and the R242A mutant and assuming that this reflects similar sulfate binding modes in both proteins, the results show that the binding event as such is not ... with Histagged StP and the R234A and R242A mutants and yielded dissociation constants for enzyme–sulfate (KdSO4) and enzyme–phosphate (KdPi) complexes These Kd values are summarized in Table The ... switches Arg234 appears to be part of the relay when phosphate is bound, but not when sulfate is bound Comparison of StP with rmGP and other a-glucan phosphorylases Structure-function studies...
- 11
- 444
- 0
Đánh giá chất lượng bản dịch Tiếng Việt tác phẩm “Chicken Soup for Mother and Daughter Soul” áp dụng mô hình của Julliane House= evaluating the vietnamese version of the book chicken soup for mother and daughter soul by jack candfield and mark victor has
... disguise‟, Mary Jo is Alice s stepmother In English, it is usual to address mother, father or adults by proper names However, it is considered disrespectful and distant in Vietnamese culture So, ... House s model, the researcher follows the chronological steps in translation quality assessment suggested by House Firstly, a source text (ST) is selected, and then a register analysis is done ... being used to measure the results of learning, translation quality assessment is summative 1.4.2 Approaches to translation quality assessment Translation quality assessment is a controversial issue...
- 62
- 1,157
- 5
SEVERAL THESES ON THE SUBJECT OF INTERCULTURAL THEATRE SUPPLEMENTED BY SEVERAL KEY EXAMPLES THAT INCLUDE STATIONARY WRITERS, TRANSLATIONS, TRAVELLERS ON FOOT, HORSES, OR VESSELS, AND SEARCH ENGINES
... creates and destroys the discourse In that sense, there is still something singular in that process I so by choosing to write and perform my theses and consider the clashes and tensions that arise ... of his essays/lectures and his public persona, his paths and counter-paths, his travel narratives, his spur of the moment, his slips, personal relationships with his friends and foes, his mourning; ... CHARTING THE THESIS This is a thesis on ― what a thesis on Intercultural Theatre can be Before delivering the message of the thesis, I envisage the following customary premises that are required to situate...
- 159
- 684
- 0
Cadmium Removal by the Hydroponic Culture of Giant Reed (Arundo donax) and Its Concentration in the Plant
... Meanwhile, the decreasing rate of the cadmium concentration was higher in early period This is another aspect which is presented in the succeeding discussion with the dynamics of GSH Concentration ... was basically the same as that in the previous study (Sagehashi et al., 2009) The volume of the total culture broth was set as L and was circulated by a liquid pump To avoid the direct effects ... cultivated wetland is not enough to design the multi-functional wetland The purposes of this study are thus to clarify the dynamics of cadmium removal by giant reed, and investigate its concentration...
- 7
- 701
- 0
ENGLISH ADVERBS OF MANNER AND TYPICAL ERRORS MADE BY THE STUDENTS AT LE HONG PHONG SPECIALISED SECONDARY SCHOOL, NAM DINH CITY
... visited them increasingly frequently iii The construction with less and less A similar construction, employing the expression less and less, can also be used The expressions less and less and ... exercises and tests for these students for the following reasons The first reason is that this part of grammar was first introduced to students when they were in grade seven If it is not revised ... Therefore, further research on these errors should be conducted Moreover, the sample in this thesis is very small so it is suggested that other studies on the same subject with bigger samples should...
- 55
- 1,084
- 8
A study on common grammatical and lexical errors in writing compositions made by the first year english major students at hai phong private university and some suggested solutions
... structures and functions of the elements in a sentences As the results , they write the very foolish and incomprehensive sentences 1.2 Laziness As the survey said in 1.1, the first year English major ... of students says that they never that 30% students sometimes and 54% always this These statistics are shown by the following chart: - 29 - never always sometimes sometimes never always 0% 10% 20% ... grades of English major students , etc These issues are suggested for further study Once again, all sincere thanks are sent to everyone who gives me supports and encouragements as well as precious...
- 56
- 2,611
- 13
An investigation the common errorrs in paragraph writing made by the second year students at vinh universite and some suggested solutions
... instruments and procedures It also presents the results collected from the questionnaire and the analysis of errors made by students from their homework papers and midterm tests in the form of tables and ... correction, some famous error linguists such as James (1998) and Edge (1989) suggest that it is necessary to correct errors because it is useful for both teachers and learners In his book “Mistakes and ... the survey, which includes the aims, the description of the subjects, research setting, and the ways to carry out the study The results of the study are presented followed by the discussion and...
- 22
- 1,847
- 14
A CASE STUDY ON COMMON PROBLEMS IN LEARNING BUSINESS ENGLISH VOCABUALRY IN THE BOOK “BUSINESS BASICS” FACED BY THE 1ST YEAR STUDENTS AT VIETNAM UNIVERSITY OF COMMERCE, AND SOME SUGGESTED SOLUTIONS
... business vocabulary in the book “Business Basics” faced by the 1st year students in VUC b To suggest some solutions to improve the students’ vocabulary learning Scope of the study This study is ... gestures, and facial expressions and other ways are least liked because in business English, it is not easy for the 21 teacher to find appropriate visual aids, or present words by mimes, gestures and ... sentences They are confused in what parts of speech to choose to make a sentence” Instead of using the adjective successful, they use the noun success, For instance, he is a success man in business;...
- 42
- 1,338
- 3
Noun phrases in some selected chapters from “pride and prejudice” by jane austen and the equivalents in the translated version in vietnamese
... been selected partly because they are, in some sense, typical and partly because they raise issues which the author will be discussing in detail later “Translation is the expression in another ... sentences and discourse structures, but also the symbolic nature of distinguishing between designative and associative 12 meanings It also emphasizes the fact that everything about a message carries ... premodifier, as its name suggests, precedes the thing and has the functions of specifying (i) a class of thing, and (ii) some categories of membership within the class The membership within the class is...
- 58
- 1,056
- 5
Tìm thêm: xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng 9 tr 25