firm means any entity whether or not a legal person that is not an individual and includes a body corporate and a partnership or other unincorporated association
Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf
... QLQRDALRHFAPCPPRARGLQEARVALEPALEPGFAARLQAQRICLERADAGPLGVAGS RAT R3E 119 QLQRDALRHFAPCPPRTRGLQDARIALEPALEPGFAARLQAQRICLERADAGPLGVAGS HUMAN R3E 119 QLQRDALRHFAPCQPRARGLQEARAALEPASEPGFAARLLTQRICLERAEAGPLGVAGS PP1 ... ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPSPPRADRFAFRLPAPPVGGTLLF RAT R3E 178 ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPAPPRADRFAFRLPAPPVGGALLF HUMAN R3E 178 ARVVDLAYEKRVSVRWSADGWRSQREAPAAYAGPAPPPPRADRFAFRLPAPPIGGALLF GM/ RGL/R 3A ... gacgaggcgcctgcggccgacggcggaaaacaccaaaggcacccgggggcggggcgacccgatgtggcggggaggagtag 920 I H F I * 279 921 gagagaccaggattggcgggagcggtccaagggagtc 957 Fig (A) Diagram of human PPP1R3E mRNA compared with PPP1R3E...
- 12
- 381
- 0
Tài liệu Equal Access Means Equal Opportunity for All: Creating a Real-Time Statewide Advanced Placement Consortium February, 2003 ppt
... AP Consortium staff will: – Recruit AP teachers – Arrange for their summer training at UW-Madison or Lawrence University [Appleton] – Help principals and counselors make a wide range of AP distance ... Project Director, 12/3/02 Quoted with permission.] NUTS & BOLTS PLAN OF ACTION I Create, operate, and maintain a statewide advanced placement distance learning clearinghouse for all Wisconsin high ... training course at UW-Madison and Lawrence University for AP teachers – AP Instructional Content: UW Division for Continuing Studies and Lawrence University – AP Distance Education Approaches: UW Extension...
- 20
- 452
- 0
Tài liệu Báo cáo khoa học: PCR detection of nearly any dengue virus strain using a highly sensitive primer ‘cocktail’ ppt
... CAAACCATGGAAGCTGTACG TTCTGTGCCTGGAATGATGCT GAGTGGAGTGGAAGGAGAAGGG CCTCTTGGTGTTGGTCTTTGC CAGACTAGTGGTTAGAGGAGA GGAATGATGCTGTAGAGACA ATATGCTGAAACGCGTGAG CATCATGAGACAGAGCGAT TTCCAACAAGCAGAACAACAT GCTACAGGCAGCACGGTTT ... 5¢-Forward-3¢ 5¢-Reverse-3¢ CAAACCATGGAAGCTGTACG TTCTGTGCCTGGAATGATGCT CAAACCATGGAAGCTGTACG TTCTGTGCCTGGAATGATGCT GAGTGGAGTGGAAGGAGAAGGG CCTCTTGGTGTTGGTCTTTGC CAGACTAGTGGTTAGAGGAGA GGAATGATGCTGTAGAGACA ... CAGACTAGTGGTTAGAGGAGA GGAATGATGCTGTAGAGACA ATATGCTGAAACGCGTGAG CATCATGAGACAGAGCGAT TTCCAACAAGCAGAACAACAT GCTACAGGCAGCACGGTTT Average efficiency ± SD Template Optimal PCR conditions Cocktail PCR conditions DENV-1...
- 12
- 795
- 0
Báo cáo khoa học: "Japanese Named Entity Recognition based on a Simple Rule Generator and Decision Tree Learning" pdf
... of According to this ordering, two candidates can have the same rank One of them might assert that a certain word is an organization’s name and another candidate might assert that it is a person s ... pub/ packages/ memt, January I would like to thank Yutaka Sasaki, Kiyotaka Uchimoto, Tsuneaki Kato, Eisaku Maeda, Shigeru Katagiri, Kenichiro Ishii, and anonymous reviewers Manabu Sassano and Takehito ... Message Understanding Conference, pages 157–166 Morgan Kaufmann Kiyotaka Uchimoto, Qing Ma, Masaki Murata, Hiromi Ozaku, Masao Utiyama, and Hitoshi Isahara 2000 Named entity extraction based on a...
- 8
- 530
- 0
To Cut or Not to Cut? That is the (Central Bank’s) Question In Search of the Neutral Interest Rate in Latin America pdf
... Guatemala, and Paraguay, still have a See Marques and Manrique (2004) for Germany and the United States, Andres et al (2009) for the United States and the Euro area, Basdevant et al (2004) for ... term has zero mean and variance We also assume that potential GDP grows at a rate g, which follows a random walk with zero mean and variance We add an auxiliary variable to model the fact that ... (2003) for New Zealand; Lam and Tkacz (2004) for Canada; and Adolfson et al (2011) for Sweden See for example, Ogunc and Batmaz (2011) for Turkey; Calderon and Gallego (2002) and Fuentes and Gredig...
- 48
- 504
- 0
Báo cáo khoa học: H2O2, but not menadione, provokes a decrease in the ATP and an increase in the inosine levels in Saccharomyces cerevisiae An experimental and theoretical approach pot
... essentially the same in both cases and, above all, no appreciable differences in the rates of disappearance of ATP or appearance of Ino were observed Theoretical approach mathematical simulation ... our laboratory [3] In that work, the metabolic pathways of AMP, GMP, IMP and XMP catalyzed by rat brain cytosol were explored using two complementary (experimental and theoretical) approaches ... in Table were used similar rates of disappearance of substrates and appearance of products (Fig 5B) Inhibition of glycolysis as a plausible theoretical explanation for increased inosine Yeast...
- 12
- 506
- 0
Báo cáo " Self-regulated strategy development as a means to foster learner autonomy in a writing course " pdf
... procedure for SRSD is adapted from the literature on SRSD (e.g Graham and Harris [19]; Mason, Harris and Graham [18]; Harris, Graham and Mason [20]; Chalk, Hagan-Burke and Burke [21]) Information ... enter interaction and collaboration with the teacher and peers and receive feedback and scaffolding for their strategy use Meanwhile, the teacher can collect information about their writing and self-regulation ... replacing it This way, the students will learn and apply the strategies in the real writing task and the chance that they are going to memorize, generalize, and maintain them is increased A plan...
- 8
- 518
- 4
17% of cell phone owners do most of their online browsing on their phone, rather than a computer or other device pdf
... patterns This weighting also adjusts for the overlapping landline and cell sample frames and the relative sizes of each frame and each sample The second stage of weighting balances sample demographics ... telephone usage The Hispanic origin was split out based on nativity; U.S born and non-U.S born The White, non-Hispanic subgroup is also balanced on age, education and region The basic weighting parameters ... Research Associates International from March 15 to April 3, 2012, among a sample of 2,254 adults, age 18 and older Telephone interviews were conducted in English and Spanish by landline (1,351) and...
- 16
- 336
- 0
Báo cáo hóa học: " Research Article An Iterative Soft Bit Error Rate Estimation of Any Digital Communication Systems Using a Nonparametric Probability Density Function" pptx
... + a2 j − i, i, K(t)dt (A. 4) For a zero mean and unit variance Gaussian Kernel, the second and fourth moment are, respectively, equal to and 3, that is, t K(t)dt = and t K(t)dt = Therefore, (A. 4) ... random variable X depends on both the type of receiver and the channel model; Gaussian function for a simple additive white Gaussian noise (AWGN) channel, a mixture of Gaussian functions for an ... consider any point to point system communication over any channel transmission (Gaussian, multipath fading, etc.) with or without channel coding using any transmission techniques (CDMA, MC-CDMA, TDMA,...
- 9
- 340
- 0
Báo cáo hóa học: " Research Article Integral Means Inequalities for Fractional Derivatives of a Unified Subclass of Prestarlike Functions with Negative Coefficients" ppt
... Raina and Srivastava [6] (1.12) ¨ u H O G¨ ney and S Owa We begin by recalling the following useful characterizations of the function class ᏼ(α,β,σ) due to Raina and Srivastava [6] Lemma 1.1 A ... Owa and B A Uralegaddi, A class of functions α-prestarlike of order β,” Bulletin of the Korean Mathematical Society, vol 21, no 2, pp 77–85, 1984 [5] H M Srivastava and M K Aouf, “Some applications ... distortion theorems I,” Kyungpook Mathematical Journal, vol 18, no 1, pp 53–59, 1978 [8] H M Srivastava and S Owa, Eds., Univalent Functions, Fractional Calculus, and Their Applications, Ellis...
- 9
- 277
- 0
Báo cáo sinh học: "TEs or not TEs? That is the evolutionary question." ppsx
... at the level of transcription, and in the T1 gene, the new ORF and ATG triplet also repress translation of the RNA transcript The study by Huang et al [2] adds a new twist to exonization: transposable ... level of exonization of transposable elements in this organ In support of this hypothesis, Huang et al [2] show that T1 and T2 are expressed exclusively in the testis and during early stages of embryonic ... Infrequently, a spliced, capped and polyadenylated cellular mRNA molecule is reverse transcribed (RT) into cDNA and integrated by retrotransposition into the genome in an intergenic region, creating an...
- 3
- 355
- 0
Báo cáo y học: "Rheumatoid cachexia is associated with dyslipidemia and low levels of atheroprotective natural antibodies against phosphorylcholine but not with dietary fat in patients with rheumatoid arthritis: a cross-sectional study" pdf
... values exist P values < 0.05 were considered significant The statistical analysis program Statistica (Stat Soft Scandinavia AB, Uppsala, Sweden), was used for statistical analysis However, anti-PC ... (63) Data is presented as mean (95% confidence intervals) for normally distributed variables and as median (interquartile range) for non-parametric variables aMedian DAS28, 28-joint Disease Activity ... senior advisor in all parts of the research and manuscript preparation All authors read and approved the final manuscript Additional files The following Additional files are available online: Additional...
- 11
- 549
- 0
báo cáo khoa học: " If you build it, they still may not come: outcomes and process of implementing a community-based integrated knowledge translation mapping innovation" pps
... in making and interpreting maps, address their general perceptions and attitudes towards maps and mapping, and ensure that a common terminology was familiar to both data analysts and managers ... contact), and exit focus groups that were recorded and transcribed verbatim for analysis As visits three and four were more interactive, these were also taped and transcribed verbatim for analysis The ... x X x G (Data Analyst) G (Manager) x x Post Visit Manager Assessment x x x x F (Data Analyst) F (Manager) x Post Visit Data Analyst Assessment x x X x E (Data Analyst) E (Manager) Visit July...
- 13
- 300
- 0
Báo cáo y học: " Pediatric chylolymphatic mesenteric cyst - a separate entity from cystic lymphangioma: a case series" potx
... chyle and lymph The accumulation of chyle and lymph is considered to be the result of an imbalance between the inflow and outflow of fluid [1] This cyst may be asymptomatic, and may cause abdominal ... the patient data retrospectively SK performed the histological examination of the kidneys, and KN and VN were major contributors in writing the manuscript All authors read and approved the final ... definite diagnosis is usually made in the postnatal period [12] The different surgical approaches used are marsupialization, sclerotherapy, drainage, enucleation, percutaneous aspiration, and excision...
- 4
- 275
- 0
Báo cáo y học: "To dose or not to dose: that is the (starch) question" potx
... Y, Konstadt SN, Bradford C, Glass PS, Machin SJ, Mythen MG: Hextend, a physiologically balanced plasma expander for large volume use in major surgery: a randomized phase III clinical trial Hextend ... criteria allows one to employ an objective means to evaluate the impact of a particular therapy on renal function Perhaps all manuscripts evaluating renal function should follow these authors’ lead ... Group Anesth Analg 1999, 88:992-998 Kellum JA, Cerda J, Kaplan LJ, Nadim MK, Palevsky PM: Fluids for prevention and management of acute kidney injury [review – ADQI Consensus Statement] Int J Artif...
- 2
- 228
- 0
Báo cáo y học: "Natural antisense transcripts with coding capacity in Arabidopsis may have a regulatory role that is not linked to double-stranded RNA degradation" ppt
... thaliana A comparison of the arrangements of overlapping gene pairs in Arabidopsis A comparison of the arrangements of overlapping gene pairs in Arabidopsis thaliana A and A' label the start and ... prediction and identification of cis-natural antisense transcripts in Arabidopsis thaliana Genome Biol 2005, 6:R30 Kiyosawa H, Yamanaka I, Osato N, Kondo S, Hayashizaki Y: Antisense transcripts with FANTOM2 ... dsRNA pathways Materials and methods Analysis of overlapping transcripts All Arabidopsis genome information, including gene ID (AGI code), transcript orientation, and gene and exon position coordinates...
- 10
- 234
- 0
LUẬN MẪU LỚP 12 Discuss the view that tolerance is essential for peace and harmony in any community or country
... moments that men also discover their own physical strength, and other advantages of resistance For instance, a man who is attacked by an animal will fiercely in an effort to avert tragedy to ... the human race is mainly a record of the battles and wars fought in the past between communities and nations Wars are caused mainly by human greed and ambition In the early days of men's existence, ... the advantages and disadvantages of having too many university graduates in your country University education confers many benefits on the individual It develops his intellect and broadens his...
- 13
- 302
- 0
Acting and not acting an experiment and investigation in a monologue b
... REHEARSAL LOG Appendix B Kaylene: Archival and historical as main framework, the other two as inserts made up of anecdotal comments from Nora and excerpts of conversations between Nora and Huang ... before finding out how to manipulate the audience Nora: - Perhaps the impetus to analyse is part & parcel of an actor‟s craft In the past, Nora don‟t tend to analyse but let the director analyse ... emotional arch in order to carry on crafting the piece - Nora‟s co-actor – Sound and slides - All the shifts & slips Nora has to it Nora: - One complication: Nora as the lecturer is also very dramatic...
- 8
- 170
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 nội dung cụ thể cho từng kĩ năng ở từng cấp độ phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25