find the maximum value of the function fx y
Report of the Sub-Committee of the Central Board of Directors of Reserve Bank of India to Study Issues and Concerns in the MFI Sector doc
... repayable within 12 months irrespective of the amount of the loan. However, the larger the loan, the larger the amount of the repayment installment, and a large installment may strain the ... is of a temporary nature or willful, the MFI may enforce recovery from other members of the Group but if there are external factors beyond the control of the borrower, some time for recovery ... lend to the same borrower. d) there must be a minimum period of moratorium between the grant of the loan and the commencement of its repayment. e) recovery of loan given in violation of the regulations...
- 65
- 551
- 0
Báo cáo khoa học: Role of the N- and C-terminal regions of the PufX protein in the structural organization of the photosynthetic core complex of Rhodobacter sphaeroides pptx
... ability f or photosynthetic growth, the insertion of PufX in the core LH1–RC complex, the stability of the dimers and the kinetics of flash-induced reduction of cytochrome b561 of the cytochrome ... ambiguous the attribution of the PufXD2)19strain to the wild-type or the PufDXcluster.Isolation of the photosynthetic complexesfrom the mutant strainsAs described previously [16], the photosynthetic ... LH1-a polypeptide has an inhibitory effecton the formation of the LH1 complex. This result suggeststhat the central core of the PufX protein is responsible of the break in the continuity of the...
- 9
- 547
- 0
The Education Of The Negro Prior To 1861 - A History of the Education of the Colored People of the United States from the Beginning of Slavery to the Civil War pdf
... that they did not then know of any schools among them exclusively forNegroes. In most parts of the State, and most commonly in the northern division, however, they wereincorporated with the ... special education of " ;the Blacks and the people of color." In 1801, however, a schoolwas kept the first day of the week by one of the members of the Society, who instructed them gratis inreading, ... colored people, the influence of the revolutionary movement was hardlynecessary to arouse the Catholics to discharge their duty of enlightening the blacks. Wherever they had the opportunity to give...
- 191
- 503
- 0
the university of north carolina press opium war 1840-1842 barbarians in the celestial empire in the early part of the nineteenth century and the war by which they forced her gates mar 1998
... flood the ear can detect a whole apocalypse in the starry night of the human body."After a while, of course, the tortures of withdrawal diminish. Eventually they disappear. Yet it is a weary ... such warnings. They had to leave their infants in the care of old women or very young children when they went off to the mills; there was nothing else they could do; and it was only common prudence ... below. There they lay for a part or all of the trading season, sometimes as many as fifty or sixty together. At their head were ships that flew the distinctive red and white striped flag of the...
- 502
- 512
- 0
báo cáo hóa học: " Measuring health-related quality of life in Hungarian children with heart disease: psychometric properties of the Hungarian version of the Pediatric Quality of Life Inventory™ 4.0 Generic Core Scales and the Cardiac Module" pptx
... chronicallyill children is known from the literature [4,11,21,25].Thepsychosocialsupportofthefamilyshouldbethepart of health care of chronically ill children. In light of the apparent limitations of ... to the single scale scores there is the possibility tocalculate summary scores: the Physical Health SummaryScore is the same as the Physical Functioning Subscale,whereas to create the Psychosocial ... Tountas Y: Measuring health-related quality of life in Greek children: psychometricproperties of the Greek version of the Pediatric Quality of lifeInventory™ 4.0 Generic Core Scales. Quality of...
- 12
- 619
- 2
báo cáo hóa học: " Evaluating the reliability, validity and minimally important difference of the Taiwanese version of the diabetes quality of life (DQOL) measurement" potx
... the future (How often do youworry about requiring insulin in the future?), death (Howoften do you worry about death due to diabetes?), andeating food (How often do you worry about eating the ... 0.45,respectively, which were larger than the satisfactiondomain (0.24). The discriminative ability of the DQOLand the D-39S by the known groups of retinopathy, neu-ropathy, and diabetic foot ... Magnitudes in the correlations of all DQOL domains with the physical relevant domains of the D-39S (diabetes control and energy/mobility) wereslightly larger than with other domains of the D-39S(social...
- 12
- 693
- 0
báo cáo hóa học: " Measurement properties of the Brazilian version of the Pediatric Quality of Life Inventory (PedsQL™) cancer module scale" pdf
... treatment [15]. The Mann-Whitney test was utilized for the analysis of thishypothesis.Construct validity was assessed by means of correlationanalysis between the subscale scores of the PedsQL™ ... for which A is the highest and E the lowest. The goal of this classification system is to estimate the buying power of each family, as measured by the quantity of products each family can afford ... andadolescent lymphoid and myeloid leukemia. Hematology /the Education Program of the American Society of Hematology American Soci-ety of Hematology 2004:118-145.3. Bowden A, Fox-Rushby JA: A systematic...
- 11
- 527
- 0
Báo cáo hóa học: " Validation of the Korean version of the pediatric quality of life inventory™ 4.0 (PedsQL™) generic core scales in school children and adolescents using the rasch model" ppt
... not be used by respondents in the way it wasintended by the developer of the scale [15]. Thus, the assumptions about both the quality of the measures andutility of the rating scale in facilitating ... considerations and by questions regarding the accuracy and acceptability of parent-proxy ratings of patients' quality of life. The Pediatric Quality of LifeInventory™ (PedsQL™) is a measure ... statistically significant differenceon the social functioning scale between healthy andunhealthy children. Comparisons to the mean scores of the other subscales within the present study to those of the...
- 15
- 688
- 0
báo cáo hóa học: " Hypoxia silences the neural activities in the early phase of the phrenic neurogram of eupnea in the piglet" docx
... showed that the time-frequency patterns at the early and late phases of the phrenic neurogram were the same for the 3–6 days old age group. As maturation pro-ceeds, the early phase of the phrenic ... although the burst activity and the continuousactivity remained, but both them appear at the late phase of the phrenic neurogram as maturation proceeds [29]. The objective of the study herein ... investi-gate the similarity on the time-frequency respiratory pat-ters during eupnea and severe hypoxia (gasping) and todetermine whether hypoxia results in changes in the time-frequency patterns of the...
- 9
- 514
- 0
báo cáo hóa học:" Assessing the construct validity of the Italian version of the EQ-5D: preliminary results from a cross-sectional study in North Italy" docx
... 1,622 adults, randomlyselected from the Registry of the Health Authorities of the city of Bologna, Italy. The primary carephysician of each subject was contacted to report on the subject's ... in the Italian population preclude its applicability. The primary goal of our study was to assess the applicabil-ity, internal consistency, and construct validity of the Ital-ian version of the ... extensively utilized in non-Italian set-tings, it lacks of empirical evaluations in Italy. The lack of information on the construct validity and reliability of the instrument as well as the absence of...
- 9
- 421
- 0
báo cáo hóa học: " Validation of the Japanese version of the Pediatric Quality of Life Inventory (PedsQL) Cancer Module" pdf
... child’s physician answered questions about the patient’s sex, date of birth, age, tumor pathology, date of diagnosis, date of completion of therap y (chemotherapy,radiation therapy, and surgery), ... practice.ConclusionsThisstudyconfirmedthereliability, validity, and feasi-bility of the Japanese version of the PedsQL 3.0 CancerModule. This is expected to help improve the q uality of life of Japanese children ... Naganuma Y, Hata Y, Kobayashi M, Miyake Y, Takeshima T, Kikkawa T: The performance of the Japanese version of the K6 and K10 in the world mental health surveyJapan. Int J Methods Psychiatr Res...
- 16
- 505
- 0
báo cáo hóa học:" Validity and reliability of the Iranian version of the Pediatric Quality of Life InventoryTM 4.0 (PedsQLTM) Generic Core Scales in children" ppt
... explanation for the discrepancy between physical functioning factor of children and their parents is their different perception of the construction of the mentioned items. Hence, the loading of the first ... study has several limitations. The unavailability of information on nonrespondents and investigation of only a sample from Tehran, the capital city of Iran, may limit the generalizability of the ... children: psychometric properties of the Greek version of the Pediatric Quality of Life Inventory(TM) 4.0 Generic Core Scales. Quality of life research : an international journal of quality of life...
- 27
- 429
- 0
Báo cáo sinh học: " The Severe Acute Respiratory Syndrome (SARS)-coronavirus 3a protein may function as a modulator of the trafficking properties of the spike protein" docx
... expression.Testing the hypothesis: The effects of 3a on the internalization of cell surface spike protein canbe examined biochemically and the significance of the interplay between these two viral ... methodology.Implication of the hypothesis: If this hypothesis is proven, it will indicate that the severe acuterespiratory syndrome-coronavirus modulates the surface expression of the spike ... "accessory"proteins of SARS-CoV are still poorly understood. The subject of this hypothesis relate to the S protein andone of the "accessory" proteins, the SARS-CoV 3a protein.The...
- 5
- 310
- 0
Báo cáo hóa học: " Contribution of cysteine residues in the extracellular domain of the F protein of human respiratory syncytial virus to its function" docx
... (ts) phenotype such as that observed for the herpes simplex type 1 gD glycoprotein [49]. The lack of anobservable ts phenotype in this study is supported by the high thermostability of the HRSV ... encoded by these mutations was misfolded insuch a way as to block the epitope recognized by the anti-body.To extend these results, the effect of the cysteine muta-tions upon the level of cell ... NAGSVSFFPQTETCKVQSNRVFCDTMNSLTLPTDVNLCNTDIFNTKYDCKIMTSKTDISSSVITSIGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKLEG PVM NAGSLSYFPSPTDCEIHNGYAFCDTLKSLTVPVTSRECNSNMYTTNYDCKISTSKTYVSTAVLTTMGCLVSCYGHNSCTVINNDKGIIRTLPDGCHYISNKGVDRVQVGNTVYYLSKEVG HMPV NAGSTVYYPNEKDCETRGDHVFCDTAAGINVAEQSKECNINISTTNYPCKVSTGRHPISMVALSPLGALVACYKGVSCSIGSNRVGIIKQLNKGCSYITNQDADTVTIDNTVYQLSKVEG...
- 11
- 343
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu