estimation of healthimpacts due to pm10 in major indian cities

Báo cáo khoa học: "Estimation of clonal contribution to cone and seed crops in a Sitka spruce seed orchard" potx

Báo cáo khoa học: "Estimation of clonal contribution to cone and seed crops in a Sitka spruce seed orchard" potx

Ngày tải lên : 08/08/2014, 23:22
... respectively, indicating improvement of the parental balance due to grouping clones into cone production levels This approach will produce evenly balanced seedlots from that seed intermediate ... Island, Washington and Oregon The orchard was established in 1971 in a random single-tree mix over unequal blocks Trees are spaced m apart and kept at approximately m in height by toppruning The ... was determined using weight data from 100 individual seeds per ramet within every clone, then the total seed crop count was calculated by dividing bulk seed weight of each ramet within every clone...
  • 7
  • 346
  • 0
Báo cáo khoa học: "Gastric outlet obstruction due to adenocarcinoma in a patient with Ataxia-Telangiectasia syndrome: a case report and review of the literature" pdf

Báo cáo khoa học: "Gastric outlet obstruction due to adenocarcinoma in a patient with Ataxia-Telangiectasia syndrome: a case report and review of the literature" pdf

Ngày tải lên : 09/08/2014, 04:21
... dilated stomach, abnormal thickening in the region of the antrum and pylorus of the stomach, and adjacent pancreas thinned due to compression from dilated stomach There was no intraabdominal adenopathy ... weeks of TPN, she was taken to the operating room for exploratory laparotomy Intra-operatively, she was found to have a large gastric mass involving the distal stomach which was determined to be ... http://www.wjso.com/content/7/1/29 Figure Hematoxylin and eosin stained sections of the gastric adenocarcinoma resected from our patient Hematoxylin and eosin stained sections of the gastric adenocarcinoma resected from...
  • 5
  • 598
  • 0
Báo cáo sinh học: "Effects of data structure on the estimation of covariance functions to describe genotype by environment interactions in a reaction norm model" potx

Báo cáo sinh học: "Effects of data structure on the estimation of covariance functions to describe genotype by environment interactions in a reaction norm model" potx

Ngày tải lên : 14/08/2014, 13:22
... appear in the estimation of variance components for such multi trait models Therefore, the application of CF is of interest to take G × E into account for example in international breeding value estimation, ... exists in both within country and international breeding value estimation The objective of this paper was to investigate the in uence of definition of EP and levels of preferential sire use in herds ... scenarios are due to differences in genetic compositions of herds and in case of herd dependent use of sires also due to the fact that sires had most of their daughters in a limited range of environments...
  • 19
  • 260
  • 0
An investigation into some types of verbal responses to questions in English and Vietnamese conversation

An investigation into some types of verbal responses to questions in English and Vietnamese conversation

Ngày tải lên : 07/11/2012, 14:54
... source to gain some significant insights in pragmatic strategies of responding acts, the situations are designed to investigate socio- 22 cultural factors including the decision of using different ... linguists pay much attention to initiating acts: requesting, complimenting, complaininghowever, the studies of responses are less mentioned Although we meet much difficult to find references to ... act of saying something in the full sense of say Illocutionary act: the act performed in saying something Perlocutionary act: the act performed by or as a result of saying For instance, in a...
  • 42
  • 1.1K
  • 4
A study of semantic and syntactic features of idioms relating to fruits in english and vietnamese

A study of semantic and syntactic features of idioms relating to fruits in english and vietnamese

Ngày tải lên : 26/11/2013, 13:21
... used in the meaning transfer of 140 100% 140 100% idioms In fact, metaphor is the concept of understanding one thing in 4.3 SIMILARITIES AND DIFFERENCES IN SEMANTIC terms of another Interestingly, ... knowledge of different cultures through learning idioms in limitations of this study cannot be avoided due to time, knowledge, general and idioms relating to fruits in particular Presenting original ... condition and history relating to idioms to understand them better Besides, learners also should pay attention to transfer meaning in process of translating idioms To master endless source of idioms,...
  • 13
  • 1.3K
  • 8
The Economic Effects of Restricted Access to Land in the West Bank ppt

The Economic Effects of Restricted Access to Land in the West Bank ppt

Ngày tải lên : 17/03/2014, 06:20
... regulations, including difficulty in obtaining an official land title, risk of confiscation, near systematic denial of permit requests and threat of demolitions, combine to maintain a high level of insecurity ... price of Palestinian products in Palestine was 76% of the price of Israeli products in 2002, and increased to 95% in 2005 65 43 Today, the constraints on the agriculture sector are overwhelming ... service in Area C, and even in Areas A and B, due to their inability to obtain permits for the installation of towers in Area C The Palestinian Energy Authority has requested the construction of three...
  • 48
  • 529
  • 0
The Economic Effects of Restricted Access to Land in the West Bank pdf

The Economic Effects of Restricted Access to Land in the West Bank pdf

Ngày tải lên : 22/03/2014, 21:20
... regulations, including difficulty in obtaining an official land title, risk of confiscation, near systematic denial of permit requests and threat of demolitions, combine to maintain a high level of insecurity ... price of Palestinian products in Palestine was 76% of the price of Israeli products in 2002, and increased to 95% in 2005 65 43 Today, the constraints on the agriculture sector are overwhelming ... service in Area C, and even in Areas A and B, due to their inability to obtain permits for the installation of towers in Area C The Palestinian Energy Authority has requested the construction of three...
  • 48
  • 598
  • 0
DOES THE STOCK MARKET RISE OR FALL DUE TO FIIS IN  INDIA

DOES THE STOCK MARKET RISE OR FALL DUE TO FIIS IN INDIA

Ngày tải lên : 25/03/2014, 11:00
... question as to whether FIIs are really a cause or effect of the rise or fall in the Indian stock market One of the most important features of the development of stock market in India in the last ... other side, the increasing presence of this class of investors leads to reform of securities market in terms of trading and transaction systems, making local markets at par with the international ... Money and Finance in the Indian Economy, Indira Gandhi Institute of Development Research, January 30-February 1, 2003 [28] Profit-booking tones down FII effect, The Hindu Business Line, Sunday,...
  • 9
  • 483
  • 0
THE GLOBAL BURDEN OF DISEASE DUE TO OUTDOOR AIR POLLUTION ppt

THE GLOBAL BURDEN OF DISEASE DUE TO OUTDOOR AIR POLLUTION ppt

Ngày tải lên : 29/03/2014, 18:20
... with the greatest burden occurring (not surprisingly) in the more polluted and rapidly growing cities of the developing world As a consequence of the uncertainties in this global assessment, its ... therefore, to make assumptions concerning factors such as the transferability of risk functions, exposure of the population, and its underlying vulnerability to air pollution, while trying to ensure ... of the urban population of each of the 14 regions are shown in Figure To allow the most appropriate epidemiologic studies to be used for burden estimation, the PM10 estimates were converted to...
  • 7
  • 596
  • 0
Báo cáo hóa học: " Quantitative estimation of Nipah virus replication kinetics in vitro" potx

Báo cáo hóa học: " Quantitative estimation of Nipah virus replication kinetics in vitro" potx

Ngày tải lên : 20/06/2014, 01:20
... Tm The melting curve analysis consisted of 35 cycles of incubation during which the temperature was increased from 60°C to 95°C at a rate of 0.2°C/30 s/cycle with continuous reading of fluorescence ... had a linear detection range of up to × 106 PFU/μL (Figure 2b) Beyond the detection limit and in the absence of amplification template, non-specific fluorescent signals due to binding of the ... was a latent phase of at least eight hours following initiation of infection, a period during which no significant increase in Nipah virus RNA synthesis could be detected in the infected Vero cells...
  • 7
  • 386
  • 0
Báo cáo hóa học: "MAP Estimation of Chin and Cheek Contours in Video Sequences" pot

Báo cáo hóa học: "MAP Estimation of Chin and Cheek Contours in Video Sequences" pot

Ngày tải lên : 23/06/2014, 01:20
... OF CHIN AND CHEEK CONTOURS For representing the shape of chin and cheek contours, a parametric 2D model for these contours is introduced The estimation of chin and cheek contours is done by estimation ... Using the estimated chin contour, the cheek contours are estimated in a second step ESTIMATION OF CHIN CONTOUR For estimation of the chin contour, the absolute value of the luminance gradient |g(W, ... condition of a certain position fchin of the chin contour The determination of pg |fchin (g |fchin ) is difficult since manifold disturbances like shadows, clothing, or skin variations in uence...
  • 10
  • 221
  • 0
Scientific report: "Loss of land due to construction of industrial zones and rural employment" potx

Scientific report: "Loss of land due to construction of industrial zones and rural employment" potx

Ngày tải lên : 06/08/2014, 18:22
... Minister in 2001, the Provincial People’s committee started organizing auction for leasing industrial land The Kinh Bac, a private infrastructure development investor, won a tender for leasing ... Management Board are managing, monitoring enterprise business activities, and reducing administrative procedure for enterprises in order to attract investment to the IZs Generating employment for IZs ... 2007, the number of employment provided by the Que Vo IZ is increasingly, from 590 in 2005 to more than 9000 in 2007, including about 3300 local labors Compared to other zones in Bac Ninh, Que Vo...
  • 12
  • 243
  • 0
Báo cáo lâm nghiệp: "An analysis of ecophysiological responses to drought in American Chestnut" ppt

Báo cáo lâm nghiệp: "An analysis of ecophysiological responses to drought in American Chestnut" ppt

Ngày tải lên : 07/08/2014, 16:20
... Wisconsin (lat 43◦ 32’; long 90◦ 1’) Containerized seedlings were established by direct seeding into 3.7 L plastic pots containing a standard glasshouse potting substrate mixture of peat moss, pine ... years in Trenton, SC, shipped to Clemson, SC, and transplanted at × m spacing at the Clemson Forest Operations Laboratory in the spring of 2002 To simulate a natural planting but protect seedlings ... USA) during the course of a dry down To convert θ to Ψp , the non-linear relationship illustrated in Figure was used to develop the conversion equation (Fig 2) Due to the destructive nature of leaf...
  • 10
  • 302
  • 0
Báo cáo khoa học: "Eosinophilia due to osteomyelitis in a dog" pptx

Báo cáo khoa học: "Eosinophilia due to osteomyelitis in a dog" pptx

Ngày tải lên : 07/08/2014, 18:21
... elbakramernu erew shpargoidar inamarhahgijaH nihahS ,inahgheD N hallofieS 652 .31-1 ,52 ,4891 tcarP minA llamS J tac dna god eht ni sitileymoetsO CA daetS 31 396 -786 ,42 ,3891 tcarP minA llamS J troper ... ]6[ noitcefni cimetsys rehto emos ro ainomuenp ,)stelgip( noitamrof ssecsba etib -liat ,sitibelhpolahpmo ,htiw detaicossa ro ,yb dedecerp yltneuqerf si noitcefni ,slamina egral nI snamuh ni debircsed ... cideapohtrO MM htimS ,JL kinebuB 02 -9 ,811 ,4791 teV deM nnA sitietsonap cilihponisoe eninac fo serutaef cihpargoidar dna lacinilC P ereyurB 218 -187,12 ,1991 ecitcarP minA llamS mA htroN nilC...
  • 3
  • 242
  • 0
báo cáo khoa học: "Expectation of variance due to mitochondrial genes from several mating designs" ppsx

báo cáo khoa học: "Expectation of variance due to mitochondrial genes from several mating designs" ppsx

Ngày tải lên : 09/08/2014, 22:22
... a role in maternal effects including Central to the problem of estimation of variance due to mitochondrial DNA or cytoplasmic genes is the mode of inheritance Mitochondrial DNA is known to be ... given in EtsEtv (1967) Expectations of covariances involving genetic variance due to mitochondrial genes ( ) QMT are obtained assuming no mutation, no influence of heterogeneity and no paternal influence ... 1983) Methods of analysis to EYKORA , RADFORD RUMBY quantify these cytoplasmic effects have lagged B (1960) used crossing of lines in a reciprocal manner to determine the extent of cytoplasmic effects...
  • 9
  • 208
  • 0
Enhancement of tolerance development to morphine in rats prenatally exposed to morphine, methadone, and buprenorphine docx

Enhancement of tolerance development to morphine in rats prenatally exposed to morphine, methadone, and buprenorphine docx

Ngày tải lên : 10/08/2014, 05:21
... average of body weight in all of the opioid treated groups Prenatal exposure to morphine enhanced the rate of tolerance development to morphine in the offspring However, development of tolerance to ... AUC of rats after receiving first injection of buprenorphine (B) The latency and AUC of rats after receiving 4th injection of buprenorphine (C) Rate of tolerance development to buprenorphine in ... development of tolerance to morphine in prenatally methadone- and morphine-exposed offspring The morphine-induced tolerance in prenatally methadone-exposed animals might also be due to opioid receptor...
  • 10
  • 230
  • 0
báo cáo khoa học: " Intein-mediated site-specific conjugation of Quantum Dots to proteins in vivo" pdf

báo cáo khoa học: " Intein-mediated site-specific conjugation of Quantum Dots to proteins in vivo" pdf

Ngày tải lên : 11/08/2014, 00:22
... of QD's to Akt-PH-EGFP via intein mediated protein splicing In vivo conjugation of QD's to Akt-PH-EGFP via intein mediated protein splicing (a) Schematic representation of site-specific intein-mediated ... half of the intein (IC) was biotinylated and conjugated in vitro to streptavidin-coated QD's The RNA's encoding Akt-PH -IN or Btk-PH -IN were delivered into Xenopus embryos via microinjection together ... H-MVKVIGRRSLGVQRIFDIGLPQDHNFLLANGAIAANCFDYKDDDDK(Ahx-Biotin)G-NH2 Modifications: Biotin conjugated to lysine via a Ahx linker (6 carbon inert linker) A 47 amino acid peptide corresponding to C-terminal intein (IC) was synthesized...
  • 9
  • 203
  • 0
Báo cáo y học: " Cecum perforation due to tuberculosis in a renal transplant recipient: a case report" pdf

Báo cáo y học: " Cecum perforation due to tuberculosis in a renal transplant recipient: a case report" pdf

Ngày tải lên : 11/08/2014, 17:21
... amebiasis, carcinoma of the colon, Yersinia enterocolitis, gastrointestinal histoplasmosis, and peri-appendiceal abscesses closely simulate intestinal TB [8] When TB is diagnosed during routine clinical ... masks the clinical course of TB and is difficult to interpret Intestinal TB should be considered when a transplant recipient shows abdominal symptoms with no clear evidence of another infection ... right hemicolectomy with end ileostomy and transverse colonic mucous fistula was performed Necrotizing granulomatous colitis due to TB was reported in the histopathologic examination (Figure...
  • 3
  • 286
  • 0
Báo cáo y học: "Bench-to-bedside review: Mechanisms and management of hyperthermia due to toxicity" doc

Báo cáo y học: "Bench-to-bedside review: Mechanisms and management of hyperthermia due to toxicity" doc

Ngày tải lên : 13/08/2014, 10:20
... starting dose is 50 to 100 mg intramuscularly for chlorpromazine and 12 to 32 mg orally for cyproheptadine during a 24 hour period, a dose that binds 85% to 95% of serotonin receptors [6,48] An initial ... clinicians to understand the various presentations of, and treatments for, toxin-induced hyperthermic syndromes The aim of this article is to provide intensivists with an overview of toxin-induced ... lowering of increased muscle activity and heat production [33] Use rectal or urinary bladder thermocouple for monitoring temperature Maintain euvolemic state using normal saline and maintain urinary...
  • 8
  • 179
  • 0