data link properties dialog box c

Tài liệu Using the Data Link Properties Dialog Box ppt

Tài liệu Using the Data Link Properties Dialog Box ppt

Ngày tải lên : 26/01/2014, 10:20
... Recipe 1.13 Using the Data Link Properties Dialog Box Problem You want to display the Data Link Properties dialog b ox from an application so that users can create their own database connections ... handler: Data Link Dialog Button.Click Creates and displays a Data Link Properties dialog box using the Microsoft OLE DB Service Component through COM interop. The C# code is shown in Example ... DataLinkDialogForm.cs // Namespaces, variables, and constants using System; // . . . private void dataLinkDialogButton_Click(object sender, System.EventArgs e) { ADODB.Connection conn...
  • 2
  • 377
  • 0
ứng dụng của vhf data link mode 4 trong môi trường cns atm

ứng dụng của vhf data link mode 4 trong môi trường cns atm

Ngày tải lên : 22/11/2012, 09:13
... c nh tranh c a chúng nhưng th c chất chúng cung c p c c ch c năng kh cc nh tranh với c c hệ thống kh c sử dụng trong c c băng tần vô tuyến kh c. 3.2.2. C c chuẩn c a ICAO về VDL Vi c sử dụng ... mặt đất điều khiển vi c truy nhập tất c c c khe. Kiểu c a c c khe phụ th c vào kế hoạch hoạt động. • C c cơ chế thông tin ATN, c c cơ chế này cung c p c c giao th c cho dịch vụ liên kết dữ liệu ... với c c thủ t c phù hợp c ng với c c công c hiển thị sẽ giúp cho vi c c nh báo tình trạng, CDTI sẽ giúp cho vi c đảm bảo phân c ch không lưu với sự vi c trách nhiệm phân c ch đư c chia sẻ cho...
  • 124
  • 1.2K
  • 29
Tài liệu DATA STRUCTURES AND ALGORITHMS USING C# pdf

Tài liệu DATA STRUCTURES AND ALGORITHMS USING C# pdf

Ngày tải lên : 22/12/2013, 10:16
... subcategories. Linear collections can be either direct access collections or sequential access collections, whereas nonlinear collections can be either hierarchical or grouped. This section describes each of ... a Collection class using an abstract class from the .NET Framework, the CollectionBase class. T HE C OLLECTION B ASE C LASS The .NET Framework library does not include a generic Collection class for ... of these collection types. Direct Access Collections The most common example of a direct access collection is the array. We define an array as a collection of elements with the same data type...
  • 366
  • 686
  • 4
Tài liệu Module 7- Data Link Layer CCNA Exploration 4.0 pptx

Tài liệu Module 7- Data Link Layer CCNA Exploration 4.0 pptx

Ngày tải lên : 22/12/2013, 13:17
... www.bkacad.com Data Link Layer Protocols- The Frame 36H c viện mạng Bách khoa - Website: www.bkacad.com Controlling Transfer across Local Media 7 • The media access control methods described ... ring to use a controlled media access control technique called token passing. H c viện mạng Bách khoa - Website: www.bkacad.com Media Access Control Techniques 13H c viện mạng Bách khoa - Website: ... trailer fields, including addressing, QoS, type of protocol, and Frame Check Sequence. H c viện mạng Bách khoa - Website: www.bkacad.com Multi-Access Topology 27 • A logical multi-access topology...
  • 64
  • 507
  • 0
Tài liệu Phần cứng (Lớp Physical, Data Link) : Đèn liên kết(Link ) của card mạng không sáng ppt

Tài liệu Phần cứng (Lớp Physical, Data Link) : Đèn liên kết(Link ) của card mạng không sáng ppt

Ngày tải lên : 23/12/2013, 03:17
... C c trường hợp về sự c mạng c thể do phần c ng hay phần mềm: Phần c ng (Lớp Physical, Data Link) : Đèn liên kết (Link ) c a card mạng không sáng Kiểm tra đầu nối card mạng và đầu c p nối ... HUB/SWITCH Thử c m đầu c p vào một c ng kh c trên Outlet hay trên HUB/SWITCH (C ng trên HUB/SWITCH c thể bị hỏng do sét hay một số nguyên nhân khách quan) Thử thay card mạng kh c (Card mạng c ... nguyên nhân khách quan) Kiểm tra c p bằng c ng c đo c p (C thể bị đứt c p) Phần mềm (Lớp Network-Application) : Kiểm tra kết nối mạng, dịch vụ mạng Kiểm tra kết nối mạng Bư c 1 : Kiểm tra...
  • 2
  • 528
  • 0
Tài liệu Create a Detach/Attach SQL Server Database Dialog Box ppt

Tài liệu Create a Detach/Attach SQL Server Database Dialog Box ppt

Ngày tải lên : 24/12/2013, 06:17
... you can reattach the database by clicking on the tab labeled Attach Database. You can then type in the name you want to attach the database as, and click on the Locate File button to locate ... database file to attach (see Figure 7.12.) Figure 7.12. Choosing the database file to attach. Select the file and click Open. To attach the file, click the Attach Database button. The database ... be attached, and you can see it in the list of databases. To check this, you can look at the list back on the Detach Database tab; that list was refreshed when you clicked the Attach Database...
  • 8
  • 503
  • 0
Tài liệu Create a Dialog Box to Connect to a New Database, Including Listing Available SQL Servers and Databases pdf

Tài liệu Create a Dialog Box to Connect to a New Database, Including Listing Available SQL Servers and Databases pdf

Ngày tải lên : 21/01/2014, 12:20
... System.Object, _ ByVal e As System.EventArgs) Handles btnConnect.Click Dim ocnn As New OleDb.OleDbConnection() Try ' Create the connection string and open the connection ocnn.ConnectionString ... Text Databases ListBox Name lstDatabases Label Name Label3 Text Connection String TextBox Name txtConnectionString Text Not Connected Command Button Name btnConnect Text Connect 2. ... that connects you to the SQL Server, allowing you access to the databases LoginSecure Flag that specifies that you want to connect to the SQL Server using a trusted connection Databases Collection...
  • 10
  • 477
  • 0
Tài liệu Chapter 7 :Data Link Control ppt

Tài liệu Chapter 7 :Data Link Control ppt

Ngày tải lên : 16/02/2014, 08:20
... i+1  Receiver gets frame i+1 out of sequence  Receiver send reject i  Transmitter goes back to frame i and retransmits William Stallings Data and Computer Communications Chapter 7 Data Link ... 7 Data Link Control Cyclic Redundancy Check  For a block of k bits transmitter generates n bit sequence  Transmit k+n bits which is exactly divisible by some number  Receive divides ... bits  LSB of each octet indicates that it is the last octet (1) or not (0)  All ones (11111111) is broadcast Other DLC Protocols (LAPB,LAPD)  Link Access Procedure, Balanced (LAPB)  Part...
  • 51
  • 851
  • 1
Tài liệu Chapter 11 Data Link Control pdf

Tài liệu Chapter 11 Data Link Control pdf

Ngày tải lên : 16/02/2014, 20:20
... section that use error control. Stop-and-Wait Automatic Repeat Request Go-Back-N Automatic Repeat Request Selective Repeat Automatic Repeat Request Topics discussed in this section: Topics discussed ... Framing Topics discussed in this section: Topics discussed in this section: 11.18 Figure 11.7 shows an example of communication using this protocol. It is very simple. The sender sends a sequence of ... add flow control to its predecessor, noiseless channels are nonexistent. We discuss three protocols channels are nonexistent. We discuss three protocols in this section that use error control. in...
  • 103
  • 1.2K
  • 5
Tài liệu Báo cáo khoa học: The isolation and characterization of cytochrome c nitrite reductase subunits (NrfA and NrfH) from Desulfovibrio desulfuricans ATCC 27774 Re-evaluation of the spectroscopic data and redox properties ppt

Tài liệu Báo cáo khoa học: The isolation and characterization of cytochrome c nitrite reductase subunits (NrfA and NrfH) from Desulfovibrio desulfuricans ATCC 27774 Re-evaluation of the spectroscopic data and redox properties ppt

Ngày tải lên : 21/02/2014, 00:20
... isa@dq.fct.unl.pt Abbreviations: ccNiR, cytochrome c nitrite reductase; cmc, critical micellar concentration; ICP, inductively coupled plasma. Note: a web page is available at http://www.dq.fct.unl.pt/bioprot (Received ... VE 11020304050 Cytc_Ddes Cytc_Dgig NrfH_Wsuc NrfH_Sdel NrfH_Ddes CymA_Sput NapC_Rsph NapC_Ppan NapC_Abra NapC_Paer DCKTCHHKW. DGAGAI QPCQASG KCDDCHHD. . PGDKQYAGCTT DG WQHSSHAE RASCVECHLPTGNMVQKYISKARDGWNHSVAFTLGT ... (Merck) column (25 · 0.4 cm, C1 8, 5 lm particle size). DNA sequencing. Based on NrfH N-terminal sequence previously acquired by chemical sequencing, the oligonucle- otide ccNiR_GTPRNGPW, 5¢-GGIACICCIMGIAAYG GICCITGG-3¢,...
  • 12
  • 593
  • 0

Xem thêm