closed form solution of i v characteristic for a si h solar cells
Design, fabrication and characterization of thin film materials for heterojunction silicon wafer solar cells
Ngày tải lên :
09/09/2015, 11:15
... heterojunction silicon solar cells shall be investigated within this thesis To maintain or even improve the a- Si: H (i) /c -Si interface quality upon the additional deposition of the doped silicon films, the ... (i. e glass and intrinsic a- Si: H) are investigated It is demonstrated that an intrinsic a- Si: H substrate favours doped silicon film growth in this transition phase region at device relevant thickness ... process of a SiH4 plasma, the inelastic electron-impact process leads to reactive neutral species such as SiH, 22 SiH2, SiH3, Si2 H6 , H and H2 , and ionized species such as SiH+, SiH2+, SiH3+, and...
- 182
- 535
- 0
Design, construction and testing of an i v tester for thin film solar cells and mini modules
Ngày tải lên :
04/10/2015, 15:45
... match, irradiance inhomogeneity (spatial uniformity over the illumination area) and temporal instability (stability over time) and their classification is shown in Table 2.1 where class -A is the ... This enables the determination of various cell parameters as a function of the light intensity, which yields valuable information for thin film solar cell researchers The important device parameters ... the dynamic capacitor charging method, a set of capacitors is used as the variable load of the PV device First, the capacitors are reset to their initial state by discharging the circuit At the...
- 77
- 524
- 0
Design, construction and testing of an i v tester for thin film solar cells and mini modules
Ngày tải lên :
13/10/2015, 15:57
... match, irradiance inhomogeneity (spatial uniformity over the illumination area) and temporal instability (stability over time) and their classification is shown in Table 2.1 where class -A is the ... This enables the determination of various cell parameters as a function of the light intensity, which yields valuable information for thin film solar cell researchers The important device parameters ... the dynamic capacitor charging method, a set of capacitors is used as the variable load of the PV device First, the capacitors are reset to their initial state by discharging the circuit At the...
- 77
- 536
- 0
Fast solution of dyadic greens functions for planar multilayered media
Ngày tải lên :
10/09/2015, 08:30
... Michalski and Zheng (1990), for the multilayered isotropic or uniaxial anisotropic medium, the EFIE is not attractive since it has a highly singular kernel, which makes the evaluation of the SIs ... propagation in the anisotropic media Besides the application range of MMIC and microwave antennas, anisotropic materials have also been found to have important applications in optical devices and radar ... locations Generally speaking, the analytical solution of SIs is unavailable, and the numerical integration of SIs is a tedious task due to the highly oscillating and slowly decaying behavior of...
- 190
- 413
- 0
SIMULATION AND VERIFICATION OF PARTICLE COAGULATION DYNAMICS FOR A PULSED INPUT
Ngày tải lên :
05/09/2013, 08:40
... 0.01 Characteristic size in each section (cm) Characteristic size in each section (cm) Figure 1: Change of mass distribution (mass conc in each section) with time using the rectilinear model and ... Characteristic size in each section (cm) Characteristic size in each section (cm) Figure 2: Change of the volume weighted mean size with time for different fractal dimensions using the rectilinear ... the size of a fractal aggregate can be written as m∝lD, where l is the actual length of the aggregate and D is the fractal dimension A fractal aggregate with D
- 6
- 509
- 0
Báo cáo Y học: Modeling the three-dimensional structure of H+-ATPase of Neurospora crassa Proposal for a proton pathway from the analysis of internal cavities pptx
Ngày tải lên :
23/03/2014, 21:20
... extracytoplasmic side This pathway was predicted by identifying internal cavities lined by polar residues, an original approach that we validate by showing that it is capable of identifying the ... transfer Ion binding site II The second calcium-binding site of ATC1_RABIT is formed by six residues, nearly all of which are located on M4 This site is formed by main-chain carbonyl oxygen of Val304, ... Fig 1) The position of the side chains and hence of cavities in this domain are therefore considered as less reliable than in other parts of the model It is nonetheless of interest that residue...
- 13
- 514
- 0
The policemen were chasing after the burglar while I was going for a walk ppt
Ngày tải lên :
02/04/2014, 21:20
... policemen were chasing after the burglar while I was going for a walk 2 Các bạn di chuột v o cụm từ để biết chức cụm câu: The policemen were chasing after the burglar while I was going for a walk ... *The policemen were chasing after the burglar while I was going for a walk H nh thức cấu trúc ngữ pháp: “S + was/ were + V_ ing + while + S + was/ were + V_ ing” - Hai h nh động xảy th i i m ... “While the teacher was teaching, she came.” – Trong giáo viên giảng cô đến Ta cần lưu ý h nh động diễn chia khứ tiếp diễn, h nh động xảy chia khứ đơn Mệnh đề thứ 2: I was going for a walk” –...
- 6
- 461
- 0
Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc
Ngày tải lên :
20/06/2014, 01:20
... AAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEA NSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA SGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEK ... GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ PEVEKPQKKP TEQGGGGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA APAAQPEVEKPQKKPVIKPL Core Arg-Gly-Asp (RGD) motif italicized ... basis by which immune presentation of the epitope is achieved [10,13-16] Strategies advancing this "capsid incorporation" paradigm have evaluated a range of virion capsid proteins as well as a...
- 13
- 419
- 0
Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" pptx
Ngày tải lên :
20/06/2014, 22:20
... Alexandria University, Alexandria, Egypt 2Faculty of Industrial Education, Helwan University, Cairo, Egypt Authors’ contributions The two authors typed read and approved the final manuscript also ... comments It should be noted here that, the theorem of equiconvergence of the eigenfunction expansion is one of interesting analytical problem that arising in the field of spectral analysis of differential ... comments and suggestions, which helped us improve this work This work was supported by the research center of Alexandria University Author details Department of Mathematics, Faculty of Education, Alexandria...
- 11
- 260
- 0
Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" potx
Ngày tải lên :
20/06/2014, 22:20
... Alexandria University, Alexandria, Egypt 2Faculty of Industrial Education, Helwan University, Cairo, Egypt Authors’ contributions The two authors typed read and approved the final manuscript also ... comments It should be noted here that, the theorem of equiconvergence of the eigenfunction expansion is one of interesting analytical problem that arising in the field of spectral analysis of differential ... comments and suggestions, which helped us improve this work This work was supported by the research center of Alexandria University Author details Department of Mathematics, Faculty of Education, Alexandria...
- 11
- 268
- 0
báo cáo hóa học:" Research Article Strong Convergence Theorems of Viscosity Iterative Methods for a Countable Family of Strict Pseudo-contractions in Banach Spaces" pot
Ngày tải lên :
21/06/2014, 11:20
... scheme in either p-uniformly convex Banach space which admits a weakly continuous duality mapping or p-uniformly convex Banach space with uniformly Gˆ teaux a differentiable norm As applications, ... for nonexpansive self-mappings; iii every uniformly smooth Banach space E is a reflexive Banach space with a uniformly Gˆ teaux differentiable norm and has fixed point property for a nonexpansive ... conditions in either a reflexive and strictly convex Banach space with a uniformly Gˆ teaux differentiable norm or a reflexive Banach space E with a weakly continuous duality a mapping Other investigations...
- 21
- 379
- 0
báo cáo hóa học:" Stability of SiNX/SiNX double stack antireflection coating for single crystalline silicon solar cells" pdf
Ngày tải lên :
21/06/2014, 17:20
... are high, the transmittance is low, and it is possible to produce thin films with high reflectivity A thin film with a refractive index of 2.3 has a high reflectivity of 3%, and a film with a refractive ... to have a better passivation effect than the 80-nm-thick single-layer SiNX :H with a refractive index of 2.05 It is considered that the absorption coefficient in the ultraviolet range increases ... as the 100 -h test is performed The sample with refractive index of 2.0 has the highest lifetime of 57.8 μs after firing The effect of passivation of the hydrogenated SiNx increases after firing...
- 6
- 251
- 0
Báo cáo hóa học: "Research Article Strong Convergence Theorems of Common Fixed Points for a Family of Quasi-φ-Nonexpansive Mappings" ppt
Ngày tải lên :
21/06/2014, 20:20
... W Takahashi, Y Takeuchi, and R Kubota, “Strong convergence theorems by hybrid methods for families of nonexpansive mappings in Hilbert spaces,” Journal of Mathematical Analysis and Applications, ... relatively nonexpansive mappings in a Banach space,” Journal of Mathematical Analysis and Applications, vol 357, no 2, pp 356–363, 2009 G Lewicki and G Marino, “On some algorithms in Banach spaces ... in an iterative method for nonexpansive mappings,” Bulletin of the Australian Mathematical Society, vol 65, no 1, pp 109–113, 2002 Y Kimura and W Takahashi, “On a hybrid method for a family of...
- 11
- 270
- 0
Báo cáo hóa học: " Research Article A Refinement of Jensen’s Inequality for a Class of Increasing and Concave Functions" pptx
Ngày tải lên :
22/06/2014, 03:20
... We will consider the critical points of the left-hand side above, that is, the zeros of its derivative with respect to y By taking the derivative, the critical points are the solutions to the ... v − ev − vev ≥ 2.16 Since at v 0, the left hand above is We need only to show that v − ev − vev is nondecreasing function of v for v ≥ Its derivative is − ev vev , which is equal to zero at v ... derivative of the objective function with respect to xi is pi − θ2 2pi xi − 2xpi , where x pi xi pj xj Since xi ≤ x, the partial derivative is nonnegative, and hence, the function is nondecreasing...
- 14
- 373
- 0
Báo cáo toán học: "A new determinant expression of the zeta function for a hypergraph" ppt
Ngày tải lên :
08/08/2014, 01:20
... union of all hyperedges is V (H) In general, the union of all hyperedges is a subset of V (H) For example, if a graph (that is, a 2-uniform hypergraph) has an isolated vertex, then the union of all ... (i, j)-entry is the number of directed paths in BH from vi to vj of length with no backtracking For the bipartite graph BH associated with a hypergraph H, let V1 = V (H) and [i] V2 = E (H) Then, ... is a proper subset of V (H) A hypervertex v is incident to a hyperedge e if v ∈ e A bipartite graph BH associated with a hypergraph H is defined as follows: V (BH ) = V (H) ∪ E (H) and v ∈ V (H) ...
- 13
- 271
- 0
Báo cáo y học: "Ultrasound guided injection of dexamethasone versus placebo for treatment of plantar fasciitis: protocol for a randomised controlled trial" potx
Ngày tải lên :
10/08/2014, 21:24
... anaesthesia will be performed prior to plantar fascia injections Plantar fascia thickening Fusiform thickening of the plantar fascia is a well established feature of plantar fasciitis According ... Participants treated for bilateral plantar fasciitis will have thickness measurements taken for each individual foot However, for bilateral cases, the mean change in plantar fascia thickness for ... in identifying overall improvement in the condition Posterior tibial nerve block Studies investigating the clinical benefit of regional anaesthesia given prior to plantar fascia injection have...
- 8
- 352
- 0
Parallel i o system for a clustered computing environment
Ngày tải lên :
28/11/2015, 13:26
... parity disk array in which the data is interleaved across disks in blocks of arbitrary size Like RAID-3, it has a disk array to store the file data and puts the parity data on a separate parity ... usage of a cluster determines which of them is requisite and which is dispensable Science computing keeps driving high performance; Business requires high availability; Web service needs high ... the availability wastes too much because the whole disk array has two identical parts Mirroring is frequently used in database applications where availability and transaction rate are more important...
- 73
- 252
- 0
Leaders of change companies prepare for a stronger future
Ngày tải lên :
06/12/2015, 23:04
... Wicker, says that increasing awareness of climate change has made it far easier to win hearts and minds “The emergence of climate change as a business issue is driving sustainability,” he notes ... with financial gains clearly, as both are a part of sustainability Similarly, Dr White says, “You need a clear line of sight for sustainability to the company’s purpose.” This ideally should include ... putting much more emphasis on growing market share and preparing for the future Similarly, organisations are increasingly devoting their attention to the sales and marketing functions This further...
- 21
- 149
- 0
A comparison of different regularization methods for a Cauchy problem in anisotropic heat conduction
Ngày tải lên :
16/06/2016, 01:11
... of information available The use of any extra information available for a specific problem is particularly important in choosing the regularization parameter of the method employed Both general ... that gives the right balance between the accuracy and the stability of the numerical solution Currently, there are various criteria available for choosing the regularization parameter, but the ... Þ of the sensitivity matrix C was calculated using the NAG subroutine F03AAF (NAG Fortran Library Manual, 1991), which evaluates the determinant of a matrix using the Crout factorisation method...
- 19
- 347
- 0