... 5a and b These metal nanoposts and nanoholes can be potentially applied into photonic crystals, and also for further processing using as metal masks Conclusions We have demonstrated anovel maskless ... can be alternatively applied into some areas Nanoscale Res Lett (2008) 3:123–127 References H Masuda et al., Photonic band gap in anodic porous alumina with extremely high aspect ratio formed ... produced a large area of highly uniform hexagonally packed gold nanoposts and nanoholes in gold thin film 123 using the uniform HCP nanoholes and nanopillars of photoresist for lift-off process, as...
... and Actuators B 133 (2008) 151–155 a 153 Fig TEM images of hexagonal WO3 with Ag decorated MWCNTs (a) TEM image of hexagonal WO3 nanograins and MWCNTs, and (b) detail of Ag decorated carbonnanotubes ... NO2 at all The elaboration of a new gas sensitive composite materials technology was afterwards reported A new approach was introduced when room temperatures detection of hazardous gases was desired, ... /CNT), sensor (hex-WO3 ) and bioapplications (hydroxyapatite) Katar´na Sedl´ ckov´ graduated asmaterial engineer from the Slovak Technical ı aa University, Bratislava in 2000 She received her...
... that agricultural residues are also being actively evaluated asa potential source of raw materials for bio-based energy production andfor manufacture of structural and non-structural panels Although ... domestic and global forests today appears unlikely; societal pressures are leading to increased areas of forest reserves anda lower intensity of management on those lands that are managed for timber ... Minnesota in at least two ways: • Demand for paper is increasing steadily in Minnesota with continued growth in the population and economy Assuming the same per capita use of paper in Minnesota as nationally,...
... Hada, M Ehara, K Toyota, R Fukuda, J Hasegawa, M Ishida, T Nakajima, Y Honda, O Kitao, H Nakai, M Klene, X Li, J.E Knox, H.P Hratchian, J.B Cross, C Adamo, J Jaramillo, R Gomperts, R.E Stratmann, ... 448 Nanoscale Res Lett (2007) 2:447–449 Table Calculated total energy of singlet and triplet state for boron and nitrogen doped single wall zig-zag and armchair carbonnanotubes Formula Type ... O Yazyev, A. J Austin, R Cammi, C Pomelli, J.W Ochterski, P.Y Ayala, K.Morokuma, G .A Voth, P Salvador, J.J Dannenberg, 449 V.G Zakrzewski, S Dapprich, A. D Daniels, M.C Strain, O Farkas, D.K Malick,...
... genome (release hg19) accounted for miRNAs annotated in mirBase (release 16) Other small RNA species, such as piwi-interacting RNAs (piRNAs) and small nucleolar RNAs (snoRNAs), were also identified ... renilla and firefly luciferase activities were assayed with the Dual Glo Luciferase Assay System (Promega) and measured with a luminometer (Luminoskan Ascent, Thermo Scientific, Waltham, MA, USA) ... extracted and analyzed at day of differentiation Mature miRNA expression was evaluated using Mirscript assays (Qiagen SA) as specified by the manufacturer’s protocol Real-time PCR was performed...
... et al., 2002; Miyata and Yahara, 1995) Studies have demonstrated that CK2 also interacts with other 11 proteins, such as tubulin and FAS-associated factor 1, that may be involved in the targeting ... co-immunoprecipitation approach in our search fornovel interacting proteins Using the former approach, the catalytic α subunit of protein kinase CK2 (formerly known as casein kinase 2) was isolated from rat ... advices and critical comments of my manuscript All the past and present members of IMCB and our laboratory for making it a great place to work in, as well asfor all the help, advices and scientific...
... substrate RNA was indicated by the bold arrow In summary, RNAs have characteristics that are amenable for development as biomolecular sensors Both in nature and in the laboratory, RNAs have been ... predominates in South Asia, Eastern Europe, Northern Asia, Central and most of South America, and are mostly CQS except in PNG and Indonesia Pv accounts for about 25% of reported cases in US 3) Plasmodium ... Plasmodium ovale occurs mostly in West Africa, occasionally in South East Asia and PNG., and are all CQS 4) Plasmodium malariae occurs at low frequency in patchy distribution worldwide, and are CQS...
... GGATCCGATCGTGTCGAACGAGATCA 60.0 KHWTTSS2P3 GGATCCGGCATCGACGGTATTCT 66.9 KHWTTSS2P4 AAGCTTATATCGCCGGGATAGCGTA 66.9 BTTTSS2P1 aaGAATTCGGTGGCCTCCAGAAACAGT 55.0 BTTTSS2P2 aaGGATCCGAGGACCCGCATGACAAG 55.0 ... Pseudomonas syringae and R solanacearum have been elucidated using Arabidopsis asa plant model (Quirino and Bent, 2003) 3.2 Materials and Methods 3.2.1 Plant Materials 3.2.1.1 Tomato and Arabidopsis ... koalas, kangaroos, deers, cats, dogs and gorillas (Sprague and Neubauer, 2004) Cases in animals have been reported in several countries including Australia, China, Thailand, Iran, Saudi Arabia, South...
... clinical trial, assigned according to the randomization list The appropriate package was handed to the particular participant Statistical data analysis and power calculation Statistical data analysis ... GAC AGA ATG TAC ACT TCA 24 nt tuf-S CCA TCA AGC CGC ACA CCA AGT TCG 24 nt Lacto-F2 TGG AAA CAG ATG CTA ATA CCG 21 nt Lacto-R2 CGT CCA TTG TGG TAG ATT CCC T 22 nt Lacto-S CTG AGA CAC GGC CCA WAC ... WAC TCC TAC GG 26 nt F_reut_IS ACC GAG AAC AAC GCG TTA TTT 21 nt R_reut_IS CAT AAC TTA ACC TAA ACA ATC AAA GAT TGT 30 nt P_reut_IS ATC GCT AAC TCA ATT AAT 18 nt Ampl Lit 159 bp (Yang et al., 2002)...
... thermal CVD, Hot filament plasma CVD, Microwave plasma CVD, RF plasma CVD, etc Synthesis methods of CNT (cont’) • CVD – Thermal CVD – – – – uses C2H2 gas and Ni, Fe, Co or all together asa catalyst ... He or Ar gas and maintain 500 torr – Use laser, vaporize graphite Synthesis methods of CNT (cont’) CVD (Chemical vapor deposition) – Advantages : temperature, the insert gas, pressure, gas flow, ... Chapter : Polymer nanocomposites filled with nanoparticles Part II Carbonnanotubesas nanofillers Allotropic forms of Carbon Curl, Kroto, Smalley 1985 graphene Iijima 1991 (From R Smalley´s...
... complexes (A) EMSA was performed with RGG3 (lanes and 4) and 32P-labeled Htelo (lanes and 2) or rHtelo (lanes and 4) (B) EMSA was performed with RGG3 (lanes and 4) and 32P-labeled rHtelo (lanes and ... ACA G) and EWS reverse d(CGC TCG AGT CAC TAG TAG GGC CGA TCT CTG C), for pGEX–EWS; EAD forward d(CGG AAT TCA TGG CGT CCA CGG ATT ACA G) and EAD reverse d(CGC TCG AGT CAT CCG GAA AAT CCT CCA GAC ... and 32P-labeled ETS-1 (lanes and 4) or ssDNA L (lanes and 2) (B) EMSA was performed with EWS (lanes 2, and 6) and 32P-labeled Htelo (lanes and 4), dsHtelo (lanes and 6) or ssDNA S (lanes and 2)...
... Toyobo (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic acid was obtained from ... 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK *****::*.** : ... 5¢-GGAATTCCATATGAAGCGCCTTTCCCTG3¢ (forward primer) and 5¢-CCAAGCTTTCACGCCCGCA CCTCCTCCCTAG-3¢ (reverse primer) PCR was carried out at 94 °C for min, and this was followed by 30 cycles of 94 °C for...
... this strain and the ability of a cell harboring an individual library member to form a colony on minimal agar media lacking added phenylalanine and tyrosine reports on the chorismate mutase activity ... substrate in three dimensions and enables their tremendous stabilization of transition states Most amino acids in an enzyme thus serve both as spacers between, andasa scaffold for, the critical active ... and chorismate mutase–prephenate dehydratase were deleted Monofunctional versions of the dehydratase and the dehydrogenase are provided by plasmid pKIMP-UAUC Random gene libraries are introduced...
... Source: [52] a Canadian figures for 2000 from Statistics Canada (Statistics Canada, 2002) The data and analysis related to the availability and quality of childcare for Canadian women and those from ... by social democratic (Sweden, Finland, Norway, Denmark, and Austria), Christian democratic (Belgium, Netherlands, Germany, France, Italy, Switzerland), or liberal Anglo-Saxon (Canada, Ireland, ... Regulated childcare spaces are available for only 10% of Canadian children 0–12 Canada—in despite of repeated political commitments to such a program—has no national childcare program in contrast...
... -MASSPTKILCDAGESDLCRDDAAAFLLKFVAIASIL 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF TjZNT1 TjZNT2 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFA ... in YNB medium at 30 °C, and imaged with a laser scanning confocal microscope (FV 1000; Olympus, Tokyo, Japan) Metal accumulation assay The Cd2+ accumulation assay was performed as described in ... Thlaspi caerulescens asa model system Ann Bot 102, 3–13 Weber M, Harada E, Vess C, Roepenack-Lahaye E & Clemens S (2004) Comparative microarray analysis of Arabidopsis thaliana and Arabidopsis halleri...
... students, and community associations The program worked by offering discounted bus passes to individuals who purchased passes as part of a larger group-purchasing program The discount pass acted as an ... Community-Based Social Marketing asa Planning Tool local, state, and federal government agencies” (Global Action Plan) The U.S program is part of a larger international effort that is operating in ... qualitative and quantitative information For example, quantitative information is found through literature reviews and samples taken from community surveys, and qualitative information is gained...
... sensory nucleus and the lateral parabrachial nucleus of the brainstem A small number of scattered NPS-positive cells were found in other brain areas, such as amygdala and hypothalamus The NPS-producing ... Synthetic NPS agonists and antagonists will also be crucial to discover and study further physiological functions of NPS and validate its potential asa drug target NPS and its receptor are a very recent ... 12 van der Werf YD, Witter MP & Groenewegen HJ (2002) The intralaminar and midline nuclei of the thalamus Anatomical and functional evidence for participation in processes of arousal and awareness...
... GlcNAcb13Galb1-4GlcNAcb-pNP was measured by HPLC as described in the Analytical methods Materials and methods Analytical methods Materials Endo-b-galactosidases from E freundii and B fragilis were from Seikagaku ... UDP-GlcNAc and UDP-Gal were kind gifts from Yamasa Corporation (Choshi, Japan) All other chemicals were obtained from commercial sources Enzyme assay b-D-Galactosidase, b-D-glucosidase and b-NAHase activities ... standard assay was carried out as follows A reaction mixture (500 lL) containing an appropriate substrate and endo-b-galactosidase in 10 mM sodium acetate buffer (pH 5.8) was incubated at 37 °C, and...