0

bilateral assistance programs are working to securenuclear materials and warheads detect nuclearsmuggling eliminate excess nuclear material andhalt production of plutonium but challenges remain

Chapter 1 Introduction to Routing and Packet ForwardingRouting Protocols and Concepts quangkien@gmail.com.Topicsl Inside the Router Ÿ Routers are computers Ÿ Router CPU and Memory Ÿ Internetwork Operating System Ÿ Router Bootup Process Ÿ Router Ports doc

Chapter 1 Introduction to Routing and Packet ForwardingRouting Protocols and Concepts quangkien@gmail.com.Topicsl Inside the Router Ÿ Routers are computers Ÿ Router CPU and Memory Ÿ Internetwork Operating System Ÿ Router Bootup Process Ÿ Router Ports doc

Quản trị mạng

... Dynamic Routing Protocols: RIP and OSPF l RIP uses hop count Ÿ R1 to R3 Ÿ Fewer links but much slower l OSPF uses bandwidth Ÿ R1 to R2 to R3 Ÿ More routers but much faster links 31 To reach the 192.168.1.0/24 ... the IOS stored? ROM Where is IOS permanently stored before it is copied into RAM? FLASH Where are the bootsystem commands stored which are used to locate the IOS? NVRAM running-config IOS (running) ... Interface normally refers to interfaces that are capable of sending and receiving user traffic l Note: However, these terms are often used interchangeably in the industry and even with IOS output...
  • 79
  • 457
  • 0
Working to support orphans and vulnerable children in southern Africa pdf

Working to support orphans and vulnerable children in southern Africa pdf

Khoa học xã hội

... development and quality of life of orphans and vulnerable children and youth; • Strengthen families and households to cope; • Strengthen Community Support Systems to sustain care and support to vulnerable ... stigmatisation of these children Help children and caregivers to cope with stigma and discrimination • Strengthen the ability in terms of skills and resources (capacity) of children and care givers to challenge ... intervention and working in the communities We also look into capacity of the organisation to be able to implement the intervention, that is, capacity to manage funds and capacity to monitor, evaluate and...
  • 31
  • 443
  • 0
Older adults with history of falls are unable to perform walking and prehension movements simultaneously

Older adults with history of falls are unable to perform walking and prehension movements simultaneously

Tổng hợp

... phases (i.e., sit -to- stand and stand -to- walk) to achieve a more upright position before initiating gait to ensure body stability (Chen et al., 2013) FOA began moving their hand toward the dowel ... were computed to compare age, anthropometric (height and 313 Please cite this article in press as: Rinaldi NM, Moraes R Older adults with history of falls are unable to perform walking and prehension ... is one more indication of the decoupling of walking and prehension FOA may prefer to slow down, almost to the point of terminating gait, before initiating hand movement toward the dowel These...
  • 12
  • 315
  • 0
Corporate Culture The Four Ingredients That Are Crucial to Your Company’s Success

Corporate Culture The Four Ingredients That Are Crucial to Your Company’s Success

Anh văn thương mại

... of uniqueness often opens doors to customers Brand Recognition Your philosophy may be to use marketing to get to customers You choose to become a recognized name in your local area, then expand ... destroyed careers, lives, and futures in the name of shareholders’ equity and profitability This behavior is so bad Newsweek devoted a whole issue to the subject and named the top offenders Slash and ... across town or out of town and trying to get it serviced? Much to your dismay you were told to take it back to the dealer where you bought the car What prompted that behavior was the philosophy of...
  • 34
  • 529
  • 0
Tài liệu 3 Untold Manifesting Secrets For Living The Life You Are Meant To Live! ppt

Tài liệu 3 Untold Manifesting Secrets For Living The Life You Are Meant To Live! ppt

Tâm lý - Nghệ thuật sống

... we need to survive and thrive, we want more and more to be safe and secure That’s a simple logical dynamic We carry this dynamic of excessive wanting beyond material goods into all areas of life ... positive feelings, and taking positive actions These are all good things and are integral to the process of manifestation However, your subconscious programs must be brought to awareness and the energy ... to do, but you aren’t doing them? Why is that? Are you afraid of failing? Another negative effect of this focus on material goods and results is this: we will tend to anything that it takes to...
  • 15
  • 571
  • 0
Tài liệu Edit Data and Update Changes That Are Made to an ADO.NET pdf

Tài liệu Edit Data and Update Changes That Are Made to an ADO.NET pdf

Cơ sở dữ liệu

... btnEdit button is clicked, the look of the text boxes is changed to sunken, and they are enabled for editing of the text After changing the data, when the user clicks on the btnSave button, the ... then stored back into the server, and the text boxes are changed to disabled If the btnCancel is clicked, the text boxes are changed to disabled Comments Although it takes a bit more code to handle ... on the command button with the caption How -To 4.1 When the form loads, click on the Load List button to display the customers that begin with the letter A Click the Edit button You will notice...
  • 10
  • 400
  • 0
Tài liệu Tiếng Anh lớp 1, 2 - Lesson thirteen (Bài 13) AM I...? ARE YOU...? (Tớ là...? bạn là...?) New words (Từ pdf

Tài liệu Tiếng Anh lớp 1, 2 - Lesson thirteen (Bài 13) AM I...? ARE YOU...? (Tớ là...? bạn là...?) New words (Từ pdf

Mầm non - Tiểu học

... you are not - Are you a ? - , I am - Am I a ? - , you are - Are you a ? - , I am not - Am I a ? - , you are not - Are you a ? - , I am - Am I a ? - , you are ... am - Am I fit? - Yes, you are - Are you nice? - No, I am not - Am I a director? - No, you are not - Are you a driver? - Yes, I am - Am I a secretary? - Yes, you are - Are you a cleaner? - No, ... you are - Are you a ? - , I am not Bước 4: Đọc câu sau dịch sang tiếng Việt: - Am I handsome? - Yes, you are - Are you sick? - No, I am not - Am I a pilot? - No, you are not - Are you a...
  • 6
  • 561
  • 3
Tài liệu Golf in the Year 2000, or, What we are coming to pdf

Tài liệu Golf in the Year 2000, or, What we are coming to pdf

Cao đẳng - Đại học

... woven This I put on, and next donned a pair of black knee-breeches—which seemed to be made of the same material as the shirt, but of stronger texture and black stockings, also of the same stuff ... country are very high towers, about two thousand feet high, made of steel: some are placed on mountains, so that they not require to be quite so high When we want rain, from the top of this tower are ... air, and in quite a tone of pride “She is a member of Parliament, you see, and a very rising one too Women make very good legislators but for one thing, and that is, for a 36 paltry victory over...
  • 62
  • 483
  • 0
Tài liệu FEMA Public Assistance Grant Funds Awarded to the City of Pompano Beach, Florida - Hurricane Wilma docx

Tài liệu FEMA Public Assistance Grant Funds Awarded to the City of Pompano Beach, Florida - Hurricane Wilma docx

Tài chính doanh nghiệp

... OFFICE OF INSPECTOR GENERAL of Homeland ~AY MEMORANDUM FOR: 2012 Major p, (Phil) May gional Administrator, Re 'on IV ;;ment Agency FROM: Assis nt Inspector eneral Office of Emergency ... copies of this report, please call the Office of Inspector General (OIG) at (202)254-4100, fax your request to (202)254-4305, or e-mail your request to our OIG Office of Public Affairs at DHS-OIG.OfficePublicAffairs@dhs.gov ... the complaint directly to us at (202)254-4292 • E-mail us at DHSOIGHOTLINE@dhs.gov; or • Write to us at: DHS Office of Inspector General/MAIL STOP 2600, Attention: Office of Investigation - Hotline,...
  • 7
  • 347
  • 0
Tài liệu The ZEN Approach™ to Project Management Working from your Center to Balance Expectations and Performance docx

Tài liệu The ZEN Approach™ to Project Management Working from your Center to Balance Expectations and Performance docx

Quản lý dự án

... time and cost The Zen Approach™ to Project Management / 15 Projects are often more complex and stressful than they need to be Far too many of them fail to meet expectations There are far too ... example of a normal adult who has a cup of poison in front of him and is aware of it He knows the 20 \ The Zen Approach™ to Project Management danger of poison and can help others be aware of the ... “who am I?” and cut to the core of self Thanks also to Gabriel Halpern who introduced me to Yoga and to the joy of chanting and song as a means for going beyond the intellect Thanks to N.Y Insight...
  • 23
  • 498
  • 0
Tài liệu Báo cáo khoa học: PC1⁄3, PC2 and PC5⁄6A are targeted to dense core secretory granules by a common mechanism doc

Tài liệu Báo cáo khoa học: PC1⁄3, PC2 and PC5⁄6A are targeted to dense core secretory granules by a common mechanism doc

Báo cáo khoa học

... separated by SDS ⁄ PAGE, and detected by fluorography (C) Autoradiograms similar to those shown in (B) were exposed to storage phosphor screen and quantified The ratios (mean ± SEM) of fusion protein ... relative to the initiator methionine Protein fragments were tested for their ability to sort heterologous proteins to secretory granules by attachment to a fragment of mouse IgG2b (referred to as ... …ATEESWAEGGFCMLVKKNNLCQRKVLQQLCCKTCTFQG and granule-containing cytoplasmic extensions (ACTH) Thus, the C-terminal domains of PC1 ⁄ 3, PC2 and PC5 ⁄ 6A are all equally capable of redirecting a constitutively secreted protein to granule-containing...
  • 9
  • 600
  • 0
Tài liệu Báo cáo khoa học: Calcium-binding to lens bB2- and bA3-crystallins suggests that all b-crystallins are calcium-binding proteins pptx

Tài liệu Báo cáo khoa học: Calcium-binding to lens bB2- and bA3-crystallins suggests that all b-crystallins are calcium-binding proteins pptx

Báo cáo khoa học

... solution to a final concentration of 0, 0.1, and 10 mM to bB2-crystallin and 0, 0.5, and mM to bA3-crystallin Fig Near-UV CD spectroscopy: (A) 1.1 mgÆmL)1 of bB2- and (B) 0.65 mgÆmL)1 of bA3-crystallin ... binding to this crystallin by ITC and determined the binding constant for the calcium mimic probe Terbium is believed to bind strongly to calcium-binding sites of proteins compared to calcium due to ... filtration and dynamic light scattering of the apo and holo forms of bA3- and bB2-crystallins There was no significant change in the stability and hydrodynamic radius of the both forms of proteins...
  • 13
  • 449
  • 0
Tài liệu Protest Fee Schedule for Thunder Cars: Protestor must verify with the INEX inspector that the proper tools are available to check protested items ppt

Tài liệu Protest Fee Schedule for Thunder Cars: Protestor must verify with the INEX inspector that the proper tools are available to check protested items ppt

Kĩ thuật Viễn thông

... seat mounting Hardware used to mount seat must be a minimum of grade bolts INEX APPROVED HEAD AND NECK RESTRAINT SYSTEMS ARE MANDATORY FOR DRIVERS 15 YEARS OF AGE AND YOUNGER AND RECOMMENDED FOR ... decals are mandatory and /or use of the product to be eligible for posted awards sponsored by the contingency sponsor 15 DOOR PLATES: Doorplates on driver’s side door are mandatory Doorplates and ... type of automotive steel wheel that has a 13” diameter, a 7” width and the offset of 3” to 1/4” from back rim edge to back of wheel center is permitted The minimum weight of a BF Goodrich tire and...
  • 30
  • 341
  • 0
Tài liệu Báo cáo khoa học: Type I antifreeze proteins expressed in snailfish skin are identical to their plasma counterparts doc

Tài liệu Báo cáo khoa học: Type I antifreeze proteins expressed in snailfish skin are identical to their plasma counterparts doc

Báo cáo khoa học

... software used to generate a three-dimensional model of Las-AFP clustalx and treeview (1.6.1) software were used to create an unrooted neighbor-joining tree Acknowledgements We thank M King and ... characterization of known skin-type AFPs and the presence of antifreeze activity in skin tissues of other species has led to the hypothesis that skin-type AFPs are widespread ancestors of liver-type ... candidates for production of AFPs Type I AFPs were previously isolated and characterized from the blood plasma of both Atlantic and dusky snailfish which are the largest described to date (> 9.3...
  • 10
  • 400
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "Which words are hard to recognize? Prosodic, lexical, and disfluency factors that increase ASR error rates" ppt

Báo cáo khoa học

... effects of disfluencies are highly variable depending on the type of disfluency and the position of a word relative to it Non-final repetitions and words next to fragments have an IWER up to 15% ... normally distributed random variable, with mean equal to the population mean, and variance to be estimated by the model Stated differently, a random effect allows us to add a factor to the model ... word, and whether it starts a turn, also remain unexamined The present study is designed to address all of these questions by analyzing the effects of a wide range of lexical and prosodic factors...
  • 9
  • 441
  • 0
Tài liệu Opportunities to Reduce Greenhouse Gas Emissions through Materials and Land Management Practices docx

Tài liệu Opportunities to Reduce Greenhouse Gas Emissions through Materials and Land Management Practices docx

Cao đẳng - Đại học

... economy, from extraction or harvest of materials and food (e.g., mining, forestry, and agriculture),  production and transport of goods, provision of services, reuse of materials, and,  if necessary, disposal.  EPA promotes materials management approaches that serve human needs sustainably by minimizing  ... the uses and changes in land types and forests in the U.S., including net emissions from forestland  remaining forestland, cropland remaining cropland, land converted to cropland, grassland remaining  grassland, land converted to grassland, settlements remaining settlements, landfill yard trimmings, and ... understanding of the link between materials and land management and GHG emissions, this document  presents an estimate of the portion of U.S. GHG emissions associated with materials and land  management practices. Second, it presents a set of materials and land management scenarios—...
  • 98
  • 501
  • 0
Báo cáo khoa học: Saccharomyces cerevisiae coq10 null mutants are responsive to antimycin A ppt

Báo cáo khoa học: Saccharomyces cerevisiae coq10 null mutants are responsive to antimycin A ppt

Báo cáo khoa học

... half of the coq10 q+ cells and one-fifth of the coq1 q+ cells were converted to q) and q0 after cell growth for mitochondrial preparation There are a number of cellular events that lead to mitochondrial ... binds to the N-site and blocks oxidation of cytochrome bH, resulting in a reverse flow of electrons from cytochrome bL to coenzyme Q to form the semiquinone (Fig 1) Myxothiazol, on the other hand, ... reduction of cytochrome c Using bc1 complex inhibitors, we observed that coq10 mitochondria were responsive to antimycin A but not to myxothiazol, indicating an active Q-cycle and defective transfer of...
  • 9
  • 337
  • 0
Food and Beverage Marketing to Children and Adolescents: What Changes are Needed to Promote Healthy Eating Habits? ppt

Food and Beverage Marketing to Children and Adolescents: What Changes are Needed to Promote Healthy Eating Habits? ppt

Tiếp thị - Bán hàng

... Advertiser-sponsored video games with embedded brand messages in colorful, fun and fast-paced adventures Branded toys and books Products designed to promote brand awareness and fun associations with a name or ... Animated brand characters created by companies to build product awareness and brand loyalty Sweepstakes Contests that offer the chance to win toys or other prizes with the purchase of a product ... percent of elementary schools, 71 percent of middle schools, and 89 percent of high schools.30 Direct advertising: Activities have included the distribution of products and promotional materials, ...
  • 12
  • 551
  • 0
Extent of Dental Disease in Children Has Not Decreased, and Millions Are Estimated to Have Untreated Tooth Decay pptx

Extent of Dental Disease in Children Has Not Decreased, and Millions Are Estimated to Have Untreated Tooth Decay pptx

Sức khỏe trẻ em

... dental disease and receive dental care, are not new Our reports dating back to 2000 highlighted the problem of chronic dental disease and the factors that contribute to low use of dental care by lowincome ... estimate to be about 15 percent of the total At the same time, indicators of receipt of dental care, including the proportion of children who had received dental care in the past year and use of sealants, ... related to the receipt of dental care The presence of dental sealants, a form of preventive care, is considered to be an indicator that a person has received dental care About 28 percent of children...
  • 46
  • 443
  • 0

Xem thêm