abutment s root in the research most of abutment s root is long and thin which is not really a favorable shape for abutment of frame works

nghiên cứu phục hình hàm khung cho bệnh nhân khuyết hổng xương hàm dưới bản tóm tắt tiếng anh

nghiên cứu phục hình hàm khung cho bệnh nhân khuyết hổng xương hàm dưới bản tóm tắt tiếng anh

Ngày tải lên : 03/10/2014, 11:04
... the abutment s root: in the research, most of abutment s root is long and thin which is not really a favorable shape for abutment of frame works 4.2 The effects of functional and aesthetic rehabilitation ... better the abutment This ratio is determined in X-ray of periopex 85.26% of patients in this research have this area in a good status, which is also an advantage in frame work rehabilitation  The ... This is really a challenge for the prosthesis Positions of losing teeth on jaw arch: Because the reason of the teeth loss is defects in bones, patients often lose a group of teeth The largest...
  • 24
  • 426
  • 0
Báo cáo y học: "ISOLATION OF CHLAMYDIA PNEUMONIAE FROM SERUM SAMPLES OF THE PATIENTS WITH ACUTE CORONARY SYNDROME"

Báo cáo y học: "ISOLATION OF CHLAMYDIA PNEUMONIAE FROM SERUM SAMPLES OF THE PATIENTS WITH ACUTE CORONARY SYNDROME"

Ngày tải lên : 26/10/2012, 08:57
... body At the same time, we realize disputable relevance of our results to pathogenesis and clinical manifestations of atherosclerosis The finding of C pneumoniae in serum of ACS patients does not ... conflict of interest exists References Shor A Chlamydia atherosclerosis lesion, discovery, diagnosis and treatment Springer-Verlag 2007 Yi-Wei T, Subramaniam S, Haijing L, et al Qualitative and Quantitative ... C.pneumoniae DNA in the serum samples of the patients with ACS However it is clear that TaqMan PCR is associated with some sensitivity and reproducibility issues when C pneumoniae is present in serum specimens...
  • 10
  • 782
  • 0
Báo cáo hóa học: " Phase I clinical trial of the vaccination for the patients with metastatic melanoma using gp100derived epitope peptide " pot

Báo cáo hóa học: " Phase I clinical trial of the vaccination for the patients with metastatic melanoma using gp100derived epitope peptide " pot

Ngày tải lên : 18/06/2014, 16:20
... through the multiple Page 10 of 12 mechanisms suggested elsewhere [46-51] In this regard, the discrepancies between the results of ELISPOT assay and the MHC Dextramer assay in some patients (P5 and ... capable of initiating immune responses against the melanoma Thus the further development of this agent to be used as an immunogenic antigen in vaccine related therapies against melanoma is warranted ... ELISPOT and MHC-Dextramer assay ELISPOT and the MHC-Dextramer assay are shown in the left (a, e, i, c, g and k) and right (b, f, j, d, h and l) side of each panel The arrow indicates the timing...
  • 12
  • 396
  • 0
báo cáo khoa học: "Analysis of the recurrence risk factors for the patients with hepatocellular carcinoma meeting University of California San Francisco criteria after curative hepatectomy" pot

báo cáo khoa học: "Analysis of the recurrence risk factors for the patients with hepatocellular carcinoma meeting University of California San Francisco criteria after curative hepatectomy" pot

Ngày tải lên : 09/08/2014, 01:24
... considered as significant All statistical analysis was carried out using the Statistical Package for Social Science (SPSS13) for Windows Figure Comparison of overall survival of patients within UCSF criteria ... Statistical Analysis The Chi-square or Fisher s Exact test was used to compare categorical variables as appropriate Survival estimates were determined using Kaplan-Meier analysis; the results ... factors of tumor recurrence, the characteristics of group A and B patients were compared Characteristics and comparison of the two populations are listed in Table According to univariate analysis,...
  • 6
  • 337
  • 0
Báo cáo hóa học: " The Effect of Single, Binary and Ternary Anions of Chloride, Carbonate and Phosphate on the Release of 2,4-Dichlorophenoxyacetate Intercalated into the Zn–Al-layered Double Hydroxide Nanohybrid" pot

Báo cáo hóa học: " The Effect of Single, Binary and Ternary Anions of Chloride, Carbonate and Phosphate on the Release of 2,4-Dichlorophenoxyacetate Intercalated into the Zn–Al-layered Double Hydroxide Nanohybrid" pot

Ngày tải lên : 22/06/2014, 00:20
... prevent the associated problems Materials and Methods Synthesis of LDH and the Nanohybrid All chemicals were used as received, and deionised distilled water was used throughout this work The formation ... Release Study of 2,4-D into Aqueous Solutions 20.1 Å 8.9 Å ZAN Results and Discussion Characterizations of the Sample Figure shows PXRD patterns of ZAN and its nanohybrid ZANDI As shown in the ... Fitting the data of the release of 2,4-D from the interlamellae of ZANDI, the nanohybrid into various aqueous solutions systems containing single, binary and ternary anions: chloride (a) , carbonate...
  • 7
  • 459
  • 0
Chapter 082. Infections in Patients with Cancer (Part 2) doc

Chapter 082. Infections in Patients with Cancer (Part 2) doc

Ngày tải lên : 07/07/2014, 01:20
... curative therapy for the underlying disease, the lack of a spleen predisposes such patients to rapidly fatal infections The loss of the spleen through trauma similarly predisposes the normal host ... influenzae, and Neisseria meningitidis) are the organisms most commonly associated with postsplenectomy sepsis, splenectomized persons should be vaccinated (and revaccinated; Table 82-2 and Chap 116) ... 116) against the capsular polysaccharides of these organisms Many clinicians recommend giving splenectomized patients a small supply of antibiotics effective against S pneumoniae, N meningitidis,...
  • 6
  • 392
  • 0
Creating 3D Game Art for the iPhone with Unity Part 2 docx

Creating 3D Game Art for the iPhone with Unity Part 2 docx

Ngày tải lên : 08/08/2014, 13:21
... Transform In the case of a 3D application that supports bones such as Blender and Maya, bones are also imported simply as a Transform A Transform holds the position, rotation, and scale of an ... texture atlases Using optimized shaders and not using alpha testing Summary This concludes our overall discussion of the iPhone and iPad hardware and how it relates to Unity iOS I can’t stress enough ... can see one of the iPhone shaders that ship with Unity iOS and that alpha testing disabled Also, notice that the shader is set to use alpha blending has been Â� instead FIG 1.13╇ Instead of...
  • 28
  • 339
  • 0
Báo cáo khoa học: Novel isoenzyme of 2-oxoglutarate dehydrogenase is identified in brain, but not in heart potx

Báo cáo khoa học: Novel isoenzyme of 2-oxoglutarate dehydrogenase is identified in brain, but not in heart potx

Ngày tải lên : 23/03/2014, 06:20
... tuned for tryptic peptides Processing of the spectra was performed by the use of data analysis software package and biotools software from Bruker A peptide mass tolerance of ± Da, a fragment mass ... approaches to address this challenge, because determination of isoform-specific peptides distinguishes unambiguously between isoforms which may show cross-reactivity to antibodies [36] In this study, ... RNTNAGAPPGTAYQSPLSLSRSSLATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSS RNTNAGAPPGTAYQSPLSLSRSSLATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSS QRATKEASVGPAQPQPP -AVIQESRASVSSCTKTSKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSF...
  • 17
  • 389
  • 0
The OpenCV Reference Manual Release 2.4.6.0 potx

The OpenCV Reference Manual Release 2.4.6.0 potx

Ngày tải lên : 25/03/2014, 12:21
... SparseMat::SparseMat Various SparseMat constructors C++: SparseMat::SparseMat() C++: SparseMat::SparseMat(int dims, const int* _sizes, int _type) C++: SparseMat::SparseMat(const SparseMat& m) C++: SparseMat::SparseMat(const ... in the same container is to store pointers to the base class base_class_t* instead but then you loose the automatic memory management Again, by using Ptr() instead of the raw pointers, ... it.nplanes; p++, ++it) it.planes[0] *= s; } SparseMat class SparseMat The class SparseMat represents multi-dimensional sparse numerical arrays Such a sparse array can store elements of any type that...
  • 819
  • 6.2K
  • 0
Báo cáo toán học: "The Strongly Regular (40, 12, 2, 4) Graphs" ppsx

Báo cáo toán học: "The Strongly Regular (40, 12, 2, 4) Graphs" ppsx

Ngày tải lên : 07/08/2014, 06:20
... part of the matrix The standard form of this matrix is the greatest such integer obtained by permuting the vertices of the graph In searching for the subgraphs Γy we made the assumption that the ... graphs, so only one graph is missing from the original list As a means of verifying the result a different search method was used It is this that we describe briefly in the next section The author ... adjacency matrix of a graph This may be described as follows Associated with the adjacency matrix of any graph there is a binary integer obtained by concatenating the rows of the upper triangular...
  • 4
  • 269
  • 0
Báo cáo y học: "Sensitivity of mice to lipopolysaccharide is increased by a high saturated fat and cholesterol diet" pptx

Báo cáo y học: "Sensitivity of mice to lipopolysaccharide is increased by a high saturated fat and cholesterol diet" pptx

Ngày tải lên : 11/08/2014, 08:21
... were separated and visualized on a 1.0% agarose ethidium bromide stained gel Band intensity was assessed from digital images with analysis software (UVP-Labworks Analysis), normalized to β-actin ... expression in each sample The densitometric ratio of target mRNA signal to β-actin signal was calculated Hepatic fibrosis was evaluated in formalin-fixed, paraffinembedded tissues using Masson 's ... effect of diet and LPS on hepatic iNOS expression iNOS mRNA (A) was assessed as in figure Values are expressed mean ± SE of mice are the fold increases in iNOS/β-actin mRNA signal ratio relative...
  • 11
  • 281
  • 0
báo cáo hóa học: " Clinical implications of gait analysis in the rehabilitation of adult patients with "Prader-Willi" Syndrome: a cross-sectional comparative study ("Prader-Willi" Syndrome vs matched obese patients and healthy subjects)" docx

báo cáo hóa học: " Clinical implications of gait analysis in the rehabilitation of adult patients with "Prader-Willi" Syndrome: a cross-sectional comparative study ("Prader-Willi" Syndrome vs matched obese patients and healthy subjects)" docx

Ngày tải lên : 19/06/2014, 10:20
... and located on the walkway For obese and healthy subjects the acquisition of dynamic data for both legs in a single trial was possible; for some PWS subjects it was not possible, because of the ... stance) The results are expressed as mean ± SD Statistical analysis was performed by t-test for unpaired data with Bonferroni correction, and using analysis of variance for parametric or nonparametric ... applicable, the patients Protocol All the subjects performed a three-dimensional Gait Analysis (GA) assessment at the Movement Analysis Lab of "Istituto Scientifico Ospedale S Giuseppe" GA was comprised...
  • 7
  • 531
  • 0
báo cáo hóa học:" Japanese version of the Dermatology Life Quality Index: validity and reliability in patients with acne" potx

báo cáo hóa học:" Japanese version of the Dermatology Life Quality Index: validity and reliability in patients with acne" potx

Ngày tải lên : 20/06/2014, 15:20
... was held on the specifics of the translation based on the two translations, and a single Japanese version was created A translator whose native language was English then translated the Japanese ... our psychometric assessment of the DLQI-J indicates that this scale is useful as a measure of disease-specific QOL in patients with acne The user 's manual for the DLQI-J [19] is available via http://www.i-hope.jp ... Japanese name of the disease, but instead the Japanese word for "skin" Two Japanese words correspond closely to the concept of "skin": hada mainly refers to the skin of the face, and hifu is a slightly...
  • 7
  • 394
  • 0
báo cáo hóa học:" Mapping of the EQ-5D index from clinical outcome measures and demographic variables in patients with coronary heart disease" pptx

báo cáo hóa học:" Mapping of the EQ-5D index from clinical outcome measures and demographic variables in patients with coronary heart disease" pptx

Ngày tải lên : 20/06/2014, 16:20
... (ECS), anginal stability scale (ASS), anginal frequency scale (AFS), treatment satisfaction scale (TSS) and the disease perception scale (DPS) Each scale has a range of to 100 with higher values ... exercise treadmill time, CCS = Canadian Cardiovascular Society Angina Classification, SAQ = Seattle Angina Questionnaire, ECS = exertional capacity scale, ASS = anginal stability scale, AFS = anginal ... Questionnaire, ECS = exertional capacity scale, ASS = anginal stability scale, AFS = anginal frequency scale, DPS = disease perception scale, TSS = treatment satisfaction scale estimation dataset...
  • 13
  • 334
  • 0
Báo cáo y học: "The reliability of toe systolic pressure and the toe brachial index in patients with diabetes" ppsx

Báo cáo y học: "The reliability of toe systolic pressure and the toe brachial index in patients with diabetes" ppsx

Ngày tải lên : 10/08/2014, 21:24
... Statistical analysis Data was analyzed using the Statistical Package Social Science software version 17.0 (SPSS Science, Chicago, Illinois, USA) Data from the right side only of the patient s hallux ... illustrates the Bland Altman plots between session and session for the measurement of toe systolic pressures, raters A and B This figure displays a 95% LOA bias of 3.5 with a SD bias of 12.66 ... on the results from the paired t-tests for the intra-rater data and ANOVAs for the inter-rater data for toe systolic pressures and TBI, the degree of error in the results was mostly random Random...
  • 8
  • 537
  • 0
báo cáo khoa học:" Sinus lifting before Le Fort I maxillary osteotomy: a suitable method for oral rehabilitation of edentulous patients with skelettal class-III conditions: review of the literature and report of a case" doc

báo cáo khoa học:" Sinus lifting before Le Fort I maxillary osteotomy: a suitable method for oral rehabilitation of edentulous patients with skelettal class-III conditions: review of the literature and report of a case" doc

Ngày tải lên : 11/08/2014, 23:22
... removing the auxililary implants final restauration was placed (figure 5) Discussion The main basic criteria for restauration of the edentulous maxilla and mandible are adequate bone mass and ortholalveolar ... remains pedicled on the nasal septum and vomer [3,19-24] This technique is indicated in cases with flat palatal vault as the hard palate is not relocated and only the alveolar crest is moved in a ... main disadvantage of distraction osteogenesis is the need for enough bone as basis for regeneration and fixation of a stable distractor In our patient we found a moderately severely atrophied mandible...
  • 7
  • 375
  • 0
Báo cáo y học: "Special considerations in the treatment of patients with bipolar disorder and medical co-morbidities"

Báo cáo y học: "Special considerations in the treatment of patients with bipolar disorder and medical co-morbidities"

Ngày tải lên : 25/10/2012, 10:51
... may cause transient increases in aminotransferases as well as cholestatic hepatitis [57], but hepatic disease does not appear to modify drug pharmacokinetics [60] Topiramate has been associated ... the psychiatrist may be the only physician caring for these patients on a regular basis Therefore, psychiatrists must have a high index of suspicion for medical illness, as well as a basic knowledge ... pharmacokinetics in various ways Diminished cardiac output results in a shift of blood flow to vital organs This may lead to decreased perfusion of the gastrointestinal tract and skeletal muscle...
  • 10
  • 709
  • 0
Effectiveness of PRECEDE model for health education on changes and level of control of HbA1c, blood pressure, lipids, and body mass index in patients with type 2 diabetes mellitus docx

Effectiveness of PRECEDE model for health education on changes and level of control of HbA1c, blood pressure, lipids, and body mass index in patients with type 2 diabetes mellitus docx

Ngày tải lên : 05/03/2014, 22:21
... patients (298 in each arm) Statistical analysis First, a descriptive analysis was carried out for each variable included in this study, involving the mean and SD for the quantitative variables and ... carrying out of behavior Final task: To create a list of skills and instruments in favour and against to the behavior change Session Session (Visits or 8) (Visits or 9) Reinforcing factors: The ... Hospital Carlos III SERMAS Madrid Spain Authors’ contributions MASF conceived of the study and participated in its design and perfomed the statistical analysis and drafted the manuscript FJAB, JCAH,...
  • 9
  • 654
  • 1
The management of patients with venous leg ulcers: Audit Protocol ppt

The management of patients with venous leg ulcers: Audit Protocol ppt

Ngày tải lên : 15/03/2014, 23:20
... nurses are aiming The purpose of criteria and standards is to assist in the improvement of care The ultimate aim for most of the criteria is the achievement of a standard of 100%, although it is ... first assessment Justification Justification Measurement of ABPI is to enable identification of arterial disease for referral to specialist vascular clinics and to assess the appropriateness for compression ... Criteria Assessment The records show that at the first assessment*, a clinical history (ulcer history, past medical history), physical examination (blood pressure measurement, weight, urinalysis) has...
  • 30
  • 518
  • 0