a simple input field textbox allows you to type a small bit of text right click to display cut copy paste and select all commands
Tài liệu Managed Investment Funds Product Disclosure Statement - A range of funds that allows you to create an investment portfolio that suits your individual needs ppt
... debit arrangement Each of the changes in paragraphs (a) to (f) is a separate right, and this clause A is to be read as if such change was a separately expressed right B Changes to terms and conditions ... which appear to be authorised by you WW All our customers are automatically given access to communicate with us by phone, fax and electronically You need to tell us if you not want us to accept any ... the ability to make changes to your account and transact online With FirstNet Investor, you can: WW access your account balance and transaction history WW make additional investments (if applicable)...
- 52
- 577
- 0
steps to success writing a winning statement of purpose for students in the science technology engineering and math fiel
... Circumstances “Extenuating circumstances that may have resulted in less than ideal academic credentials for graduate school.” Dr Liza Cariaga-Lo, Assistant Dean, Yale Graduate School of Arts and Sciences ... them An artist’s impression of a supermassive black hole at the center of a galaxy (NASA/MAXIM) Andrea Ghez, Astronomer, answered one of astronomy’s more important question by reporting that a monstrous ... Mention a few fields/areas that you are interested in • Write specifically for a department: you not want an overly a general statement Steps to Success Strategy: Summarize Poster Abstracts One paragraph...
- 39
- 556
- 0
Báo cáo y học: "Mutation in the loop C-terminal to the cyclophilin A binding site of HIV-1 capsid protein disrupts proper virus assembly and infectivity" ppt
... GAA CAG and 5'-TTCTGA TAA TGC TGA AAA CAT GGG TAT and inner primer pair 5'-CTC TCG ACG CAG GAC TC and 5'-ACC CAT GCA TTT AAA GTT CTA G was used As an internal control, the human β-globin RNA ... manuscript together with SA All authors read and approved the manuscript Additional material Additional File Materials and Methods The data provided herein describes in detail the materials and ... assay Viral infectivity assay (A) Detection of proviral DNA H9 cells were infected as above and total cellular DNA was prepared 16 days post-infection using Qiagen's DNA isolation kit and analyzed...
- 8
- 266
- 0
A contrastive analysis of idioms denoting humans with dispraising implications in english and vietnamese
... communication and causes misunderstanding of communicators’ N and V + N + PP ideas the habit of using idioms when communicating Semantically, we have totally a category of 18 groups of In order to ... 1.2 AIMS AND OBJECTIVES syntactic, stylistic and semantic features of IDHDIE and IDHDIV From the reasons above and in high hope of making a small 1.2.1 Aims of the Research 1.5 SIGNIFICANCE OF ... RESEARCH QUESTIONS - What are the syntactic, stylistic and semantic features of grammar and have a wide range of vocabulary can absolutely use IDHDIE and IDHDIV? idioms well because the meaning of...
- 14
- 1,852
- 4
Báo cáo khoa học: "A Computational Model of Text Reuse in Ancient Literary Texts" potx
... definitive answers, it can serve as a supplement to linguistic and literary-critical approaches to text- reuse analysis, and can be especially helpful when dealing with a large amount of candidate source ... both a simplification of and an extension to the one advocated in (Barzilay and Elhadad, 2003) On the one hand, we perform no paragraph clustering or mapping before sentence alignment Ancient texts ... Θ 4.1 Features Given the small amount of training data available4 , the feature space must be kept small to avoid overfitting Starting with the cosine similarity score as the baseline feature,...
- 8
- 536
- 0
Báo cáo khoa học: A novel mechanism of TGFb-induced actin reorganization mediated by Smad proteins and Rho GTPases docx
... GCGAAGCTTACCAGACCGTGGACTAACGA CCCACCGTCTTCGAGAACTA CTTCCTTGGTCTTGGCAGAG CCAGACTAGATGTAGTATTTTTTG ATTAGAGCCAGATGCTTAAGTCC ACCACAGTCCATGCCATCAC TCCACCACCCTGTTGCTGTA and then treated with TGFb1; alternatively cells ... antisense hRhoA sense hRhoA antisense GAPDH-F GAPDH-R Sequence (5¢- to 3¢) GGGATCAGAGTTCATAGTGAAAAGAG GCGAAGCTTCGGCCTAGCTCTCTCCCGGGTCTC GCGGGTACCAATGTGATGGGTGGACTGGT GCGAAGCTTACCAGACCGTGGACTAACGA ... pathway and of Smad function that operates in the context of a feedback inhibitory loop [41], was able to block both the activation of RhoA GTPase activity and reorganization of the actin cytoskeleton...
- 14
- 420
- 0
Báo cáo khoa học: " Comparison of a small volume of hypertonic saline solution and dextran 40 on hemodynamic alternations in conscious calves" ppsx
... and 180 minute after initiation of fluid infusion Before collection of each blood sample, systolic (SAP), diastolic (DAP) and mean systemic pressure (MAP), mean PAP and CVP, heart rate (HR) and ... the Care and Use of Laboratory Animals pp 1-70, National Academy Press, Washington DC, 1996 14 Naylor JM A retrospective study of the relationship between clinical signs and severity of acidosis ... plasma was collected and stored at –20 C until assay Changes in relative plasma volume (rPV) were calculated from Hb and Ht [18,19] Plasma sodium, potassium and chloride concentrations were analyzed...
- 6
- 366
- 0
Báo cáo khoa học: " A specific inhibitor of protein kinase CK2 delays gamma-H2Ax foci removal and reduces clonogenic survival of irradiated mammalian cells" pot
... treatment condition) before calculating the displayed mean values (and standard deviations) from at least independent determinations localized and transient changes of chromatin organization that ... sample preparation Alternatively, cells were incubated for repair prior to lysis Data analysis involved quantification of the fraction of total DNA mass in electrophoretically mobile DNA fragments ... by targeting NBS1 to DNA double-strand breaks Proc Natl Acad Sci USA 2008, 105:11200-11205 19 Ayoub N, Jeyasekharan AD, Bernal JA, Venkitaraman AR: HP1-β mobilization promotes chromatin changes...
- 13
- 289
- 0
A novel family of P-loop NTPases with an unusual phyletic distribution and transmembrane segments inserted within the NTPase domain pot
... The ASCE division includes AAA+, ABC, PilT, superfamily 1/2 (SF1/2) helicases, and RecA/F1/F0 classes of ATPases, and a large assemblage of NTPases related to the AP(apoptotic) and NACHT families ... 39 DHLAPLLATAN GIDGNPRLIKRFLNALSIRRAVA 404\DRC0009 AQTAFVVAADEAMIEYAVRKHFP DYARNYLEKLIQVPFRIPALGRSRDANLRGVV AGRRRSRRGRRGLRE 59 QALSQYAVAAR THCDRARFRRRHQATRARKAHAR 399|-like KGSAFVVAADDVFIRGAVRVHFT ... downstream of the Walker B aspartate is a shared feature of the KAP and NACHT families [13] In the KAP family proteins, one of these aspartates might function as the protonabstracting negative charge...
- 10
- 275
- 0
báo cáo khoa học: "Implementing health research through academic and clinical partnerships: a realistic evaluation of the Collaborations for Leadership in Applied Health Research and Care (CLAHRC)" pot
... negotiate and agree the practicalities of data collection at each phase and round of data collection at a local level Our study design allows us to take a flexible approach with the potential for amendment ... capture data at critical points in the implementation pathways of tracer issues We plan for data collection and analysis to be iterative and cyclical; checking our observations against MCOs, and ... research and infrastructure aimed at increasing our capability and capacity to maximise the impact of health research [5] The group also recommended that implementation researchers and implementation...
- 12
- 389
- 0
Báo cáo khoa học: " Management of a rare case of arrhythmogenic right ventricular dysplasia in pregnancy: a case report" pot
... fibrofatty tissue During pregnancy, plasma volume, cardiac output and heart rate increase, hematocrit decreases and physiologic anemia are established These changes are required for the adaptation ... diagnosis of ARVD [3] Structural, histological, electrocardiographic, arrhythmic and familial features of the disease were incorporated into the criteria and subdivided into minor and major categories ... Force of the Working Group Myocardial and Pericardial Disease of the European Society of Cardiology and of the Scientific Council on Cardiomyopathies of the International Society and Federation of...
- 4
- 232
- 0
Báo cáo y học: "A female survivor of childhood medulloblastoma presenting with growth-hormone-induced edema and inflammatory lesions: a case report" doc
... ventricle and attached to its lateral recesses The final histologic diagnosis was classic medulloblastoma A postoperative cerebral and spinal MRI in August 2000 revealed an ambiguous neoplastic residue ... AMELIORATION VISUAL IMAPIRMENT, HEADACHE GH REPLACEMENT THERAPY DEXAMETHASONE Somatotropin ADMINISTRATION 0.16 mg/Kg a week MRI: REDUCTION IN INFLAMMATORY AREAS IN BOTH THE SUPRATENTORIAL AREA AND THE ... endocrinologist assessed the girl At years and MRI: INCREASE OF PERIFOCAL EDEMA OCCUPYING THE POSTERIOR HALF OF THE RIGHT HEMISPHERE AND IN CONTACT WITH THE BASAL NUCLEI AND THALAMUS NO CLINICAL AMELIORATION...
- 5
- 220
- 0
Báo cáo sinh học: "An FPT haplotyping algorithm on pedigrees with a small number of sites" ppsx
... copies of each chromosome The description data of the two copies are called a genotype while those of a single copy are called a haplotype A specific location in a chromosome is called a site and its ... sites to an arbitrary small number of sites Preliminaries A member is an individual A set of members is called a family if it includes only two parents and their children; it is a parent-offspring ... new and old graphs correspond [12] An (s-t) mincut is an (s-t) cut where the total capacity of all the edges between S and S’ is minimum We will call an (s-t) mincut a mincut hereafter Ford and...
- 8
- 241
- 0
a comparative study of idiomatic expressions containing the word eye in english and vietnamese equivalents = so sánh đối chiếu những thành ngữ có chứa từ mắt trong tiếng anh với những thành ngữ tương đương
... eyes always look like grass-snake‟s eyes) Mouse and bat are kinds of animals which have small eyes And when the Vietnamese want to talk about someone who has an appearance expressing a nasty ... content of language We can dig out cultural features from language and explain language phenomena with culture Idioms as a special form of language exist in both of them and carry a large amount of ... information from one language or language variety into another is to reproduce as accurately as possible all grammatical and lexical features of the 36 „source language‟ original by finding equivalents...
- 44
- 2,323
- 8
A contrastive analysis of syntactic structures employed in describing trends in English and Vietnamese business articles
... are accordingly presented with a view to the data shown in charts and tables The last chapter, Implications and recommendations is a practical application one because the outcome of the contrastive ... correct and appropriate texts or utterances English business articles, to my mind, can serve as a fertile land to be cultivated for the sake of describing trends Teachers can employ business articles ... graphs, tables and diagrams, Academic English Press, New South Wales Feist, B (1996), Applied communication skills writing paragraph, Cambridge Adult Education, Cambridge Finegan, E (2004), Language:...
- 4
- 605
- 4
A modeling study of ion implantation in crystalline silicon involving monte carlo and molecular dynamics methods
... ion’s final velocity Z2 Atomic number of target (substrate atom) M2 Atomic mass of target atom (substrate atom) xviii V2 Target atom’s final velocity EC Total energy of system in center -of- mass (CM) ... chemical or plasma etching, and metallization etc Among all these processes, ion implantation and dopant diffusion are particularly strongly affected by device miniaturization and remains an active ... of experimental SIMS data and simulation for P 1keV 5×1013 atoms/cm2 0° tilt and 0° rotation and 5keV 5×1013 atoms/cm2 45° tilt and 45° rotation 84 4.13 Comparison of experimental SIMS data and...
- 305
- 302
- 0
Efficient texture synthesis with a small set of tiles
... blue and yellow in Figure 2.4 (a) These patches are rotated and arranged, with a small amount of overlap, as a diamond shape block, to cut a Wang tile from its center along four diagonals of the ... distribution of the texture primitives as the example This paper presents an approach to generate, from an input texture, a set of small textures that can be tiled to synthesize large textures Such a small ... are from the same patch of F (2) (i) For any a ∈ F, there is one a ' ∈ F, such that a ↓ a ' and a ≠ a ' ; (ii) for any a, b ∈ F and a ≠ b, we have a ↓ a ' and b ↓ b ' where a ', b ' ∈ F and a...
- 70
- 235
- 0
So, you want to go to grad school in Economics? A practical guide of the first years (for outsiders) from insiders pptx
... program, chances are you are familiar a great deal of the material If not, now it’s the time to learn it well Take your time to so; it’s not a race against time or your classmates to see who can master ... programs Both cooperation and camaraderie is the key Form a study group with students who are at the same level as you are In this way you can work together and learn the material together, and take ... an assistant professor position at your department These talks are really helpful to show you the competition among Ph.D graduates, and they may also give you an idea of the recent research topics...
- 12
- 696
- 0
“ A Powerful Collection of Sales Techniques to Help You Overcome Objections and Close More Sales Than Ever Before! ” doc
... early rather than too seldom and too late! You need to take advantage of any opportunity you have to gain commitment from your guest You not want to let the opportunity to close a sale pass you ... dinner and kids One thing leads to another, and all of a sudden, it is six months down the road, and you really haven’t gotten back around to doing what you originally had the best intentions of ... simply say, “Put your initials next to these two spots for liability and authorization, and put your name at the bottom” “I’ll get you a copy of this and your membership card and you re all set!” If...
- 24
- 529
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ mở máy động cơ lồng sóc các đặc tính của động cơ điện không đồng bộ đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng 9 tr 25