0

a simple blockage model

Báo cáo khoa học: Role of the structural domains in the functional properties of pancreatic lipase-related protein 2 pot

Báo cáo khoa học: Role of the structural domains in the functional properties of pancreatic lipase-related protein 2 pot

Báo cáo khoa học

... pancreas Biochim Biophys Acta 663, 446–456 6022 A Berton et al 13 De Caro J, Sias B, Grandval P, Ferrato F, Halimi H, Carriere F & De Caro A (2004) Characterization of pancreatic lipase-related ... the reacting antibodies were detected with goat anti-rabbit IgG conjugated with alkaline phosphatase at a : 5000 dilution Activity measurements and protein assays The lipase activity was measured ... BioWhittaker (Walkersville, MD, USA) Antibiotics were obtained from Invitrogen (Carlsbad, CA, USA) Alkaline phosphatase-labeled goat anti-(rabbit IgG), E600, tributyrin and NaTDC were purchased...
  • 13
  • 448
  • 0
Báo cáo khoa học: Expression and characterization of soluble forms of the extracellular domains of the b, c and e subunits of the human muscle acetylcholine receptor pot

Báo cáo khoa học: Expression and characterization of soluble forms of the extracellular domains of the b, c and e subunits of the human muscle acetylcholine receptor pot

Báo cáo khoa học

... 5¢-ATAGTTTAGCGGCCG CTTACTTCCGGCGGATGATGAGCGAG-3¢ for e1–219, (b) 5¢-ATAGTTTAGCGGCCGCTTAGTGATGGTGATG GTGATGCTTCCGGCGGATGATGAGCGAG-3¢ for e1– 219HIS, (c) 5¢-ATAGTTTAGCGGCCGCTTACGGCTT CCGGCGGATGATGAGCGAG-3¢ ... Tzartos SJ, Barkas T, Cung MT, Mamalaki A, Marraud M, Orlewski P, Papanastasiou D, Sakarellos C, Sakarellos-Daitsiotis M, Tsantili P, et al (1998) Anatomy of the antigenic structure of a large ... recombinant ECDs Discussion (anti -a sera) and others with a very small proportion of antibodies against a (nonanti -a sera) [26] We incubated five nonanti -a and one anti -a (82% antibodies against a) ...
  • 12
  • 394
  • 0
Báo cáo Y học: A functional role of the membrane-proximal extracellular domains of the signal transducer gp130 in heterodimerization with the leukemia inhibitory factor receptor pot

Báo cáo Y học: A functional role of the membrane-proximal extracellular domains of the signal transducer gp130 in heterodimerization with the leukemia inhibitory factor receptor pot

Báo cáo khoa học

... C46 6A( sense) 5¢-GATAAA GCACCCGCTATCACAGACTGG-3¢; C46 6A( antisense) 5¢-CCAGTCTGTGATAGCGGGTGCTTTATCTG-3¢; C49 1A( sense) 5¢-GCAGAGAGCAAAGCCTATTTGAT AACAG-3¢ and C491(antisense) 5¢-TGTTATCAAATAG GCTTTGCTCTCTG-3¢ ... AGACTGGACACATGG-3¢ and 5¢-TCGGGCCATGGC ATGCCCGGGGGTCAGAGCTGGG-3¢ for amplification of D4 of GCSFR and 5¢-TACTCTCAAGAAATG CCCGGGTCCCATGCCCCAGAG-3¢ and 5¢-GCCCAG GATGATGTGTAGCTCCCCGGGCTCTGGGGTCAA GGT-3¢ for ... PCR reactions were: pSVL(sense) 5¢-GTGTTACTT CTGCTCT-3¢; pSVL(antisense) 5¢-TCTAGTTGTGGTT TGT-3¢; C45 8A( sense) 5¢-ATACTTGAGTGGGCTGTG TTATCAG-3¢; C45 8A( antisense) 5¢-ATCTGATAACAC AGCCCACTCAAGTAT-3¢;...
  • 11
  • 583
  • 0
Báo cáo khoa học: The role of the Fe-S cluster in the sensory domain of nitrogenase transcriptional activator VnfA from Azotobacter vinelandii potx

Báo cáo khoa học: The role of the Fe-S cluster in the sensory domain of nitrogenase transcriptional activator VnfA from Azotobacter vinelandii potx

Báo cáo khoa học

... presumably rational to expect that VnfA also causes a conformational change in a similar manner to NifA; the binding of the ATP analog induces the rearrangement of the GAF and possible AAA+ (the ... lacZ A consistent result was also obtained by the b-galactosidase (b-gal activity) assay (Table S3) The accumulation of b-gal in the reporter strain was at the same level after the aerobic and ... 5¢-CAAAAGGTCTCGAATGTCCAGC CTCCCCCAATA-3¢ and 5¢-CAAAAGGTCTCAGCGCTG CGGTAGTCCTTGTAGTTGA-3¢ After digestion with BsaI, the PCR product was ligated into the BsaI site of pASK-IBA3plus The resulting plasmid,...
  • 16
  • 522
  • 0
Báo cáo khoa học: Kinetic and crystallographic analyses of the catalytic domain of chitinase from Pyrococcus furiosus – the role of conserved residues in the active site pdf

Báo cáo khoa học: Kinetic and crystallographic analyses of the catalytic domain of chitinase from Pyrococcus furiosus – the role of conserved residues in the active site pdf

Báo cáo khoa học

... mutations were 5¢-GCCACT TACTTGAACTTTGACATAGAAGCCGG-3¢, 5¢-GCCAC TTACTTGGCATTTGACATAGAAGCC-3¢, 5¢-GCCACT TACTTGGACTTTAACATAGAAGCCGG-3¢, 5¢-GCCAC TTACTTGGACTTTGCGATAGAAGCCGG-3¢, 5¢-GGAC TTTGACATACAAGCCGGTATCGATGC-3¢, ... B-factor values ˚ All atoms (A2 ) ˚ Main-chain (A2 ) ˚ Side-chain (A2 ) ˚ Substrate (A2 ) ˚ Water (A2 ) R.m.s DB values ˚ Main-chain (A2 ) ˚ Side-chain (A2 ) Ramachandran plot statisticsf Favored (%) Allowed ... Ser425 Asp423 Asp423 Trp664 Trp664 Ala526 Ala526 Asp524 Asp524 Asp522 B Asp522 Asp636 (NAG1) Tyr590 NAG2 Asp636 (NAG1) NAG3 NAG4 NAG5 Tyr590 NAG2 NAG3 NAG4 NAG5 Trp664 Trp664 Glu526 Glu526 Ala524 Asp522...
  • 13
  • 514
  • 0
Báo cáo khoa học: Dissecting the role of the N-terminal metal-binding domains in activating the yeast copper ATPase in vivo pptx

Báo cáo khoa học: Dissecting the role of the N-terminal metal-binding domains in activating the yeast copper ATPase in vivo pptx

Báo cáo khoa học

... 1528–1539 14 Arnesano F, Banci L, Bertini I, Ciofi-Baffoni S, Molteni E, Huffman DL & O’Halloran TV (2002) Metallochaperones and metal-transporting ATPases: a comparative analysis of sequences and structures ... homeostasis gene ATX1 from Arabidopsis Plant Physiol 117, 1227– 1234 20 Wakabayashi T, Nakamura N, Sambongi Y, Wada Y, Oka T & Futai M (1998) Identification of the copper chaperone, CUC-1, in Caenorhabditis ... measure phosphoenzyme formation from radioacA B Domain–domain interactions in Ccc2 tive ATP in the presence of contaminating copper, an assay which also evaluates whether the transport site has...
  • 13
  • 522
  • 0
Báo cáo khoa học: Mycobacterium tuberculosis ClpC1 Characterization and role of the N-terminal domain in its function ppt

Báo cáo khoa học: Mycobacterium tuberculosis ClpC1 Characterization and role of the N-terminal domain in its function ppt

Báo cáo khoa học

... chromatography (Fig 2A) The recombinant ClpC1 was analyzed to determine if it had an inherent ATPase activity We used radioactive ATP as the substrate and quantified the radioactive inorganic phosphate ... basal ATPase activity and has chaperone activity in preventing the aggregation of luciferase and reactivating heat-inactivated luciferase Deletion of the N-terminal conserved repeat I (amino acids ... of heat aggregated luciferase Luciferase was denatured by incubating at 43 °C for 15 To measure reactivation of luciferase, in a 50 lL reaction, 0.005 lm heat-denatured luciferase was incubated...
  • 10
  • 499
  • 0
Báo cáo hóa học:

Báo cáo hóa học: " Contribution of cysteine residues in the extracellular domain of the F protein of human respiratory syncytial virus to its function" docx

Hóa học - Dầu khí

... -RRRRFAGVVIGLAALGVATAAQVTAAVALVKANENAAAILNLKNAIQKTNAAVADVVQATQSLGTAVQAVQDHINSVVSPAITAANCKAQDAIIGSILNLY SSRRHKRFAGVVLAGAALGVATAAQITAGIALHQSMLNSQAIDNLRASLETTNQAIEAIRQAGQEMILAVQGVQDYINNELIPSMNQLSCDLIGQKLGLKLLRY ... TNPRTKRFFGGVIGTIALGVATSAQITAAVALVEAKQARSDIEKLKEAIRDTNKAVQSVQSSIGNLIVAIKSVQDYVNKEIVPSIARLGCEAAGLQLGIALTQH ADVPQSRFFGAVIGTIALGVATSAQITAGIALAEAREAKRDIALIKESMTKTHKSIELLQNAVGEQILALKTLQDFVNDEIKPAISELGCETAALRLGIKLTQH -RHKRFAGIAIGIAALGVATAAQVTAAVSLVQAQTNARAIAAMKNSIQATNRAVFEVKEGTQRLAIAVQAIQDHINTIMNTQLNNMSCQILDNQLATSLGLY ... -ARIMSPRKARFVLGAIALGVATAAAVTAGVAIAKTIRLEGEVAAIKGALRKTNEAVSTLGNGVRVLATAVNDLKDFISKKLTPAINRNKCDISDLKMAVSFGQY TNPRTKRFFGGVIGTIALGVATSAQITAAVALVEAKQARSDIEKLKEAIRDTNKAVQSVQSSIGNLIVAIKSVQDYVNKEIVPSIARLGCEAAGLQLGIALTQH...
  • 11
  • 343
  • 0
Báo cáo y học:

Báo cáo y học: " Role of the C-terminal domain of the HIV-1 glycoprotein in cell-to-cell viral transmission between T lymphocytes" potx

Báo cáo khoa học

... particle release from polarised epithelial cells was shown to occur at both apical and basolateral membrane surfaces, yet in its presence release occurred exclusively at the basolateral membrane ... HIV-CA, was established by intracellular p24 FACS (10,000 gated cells were analysed in each case) The value obtained for pNL-Wt was set at 100% and the values for pNL-Tr712 and pNL-EnvFus- calculated ... signalling cascades that govern polarisation of HIV-1 Gag to the VS have been identified [18], it remains unclear which domains of viral Env and Gag proteins are operational in mediating transport...
  • 11
  • 218
  • 0
Báo cáo y học:

Báo cáo y học: "Role of the long cytoplasmic domain of the SIV Env glycoprotein in early and late stages of infection" ppt

Báo cáo khoa học

... Software (Applied Biosystems) based on published rhesus macaque sequences IFNγ : F – GAAAAGCTGACCAATTATTCGGTAA, R – GCGACAGTTCAGCCATCACTT, P – 5'FAM – CCAACGCAAAGCAGTACATGAACTCATCC – TAMRA-3'; ... GTCATCGATTTCTTCCCTGTGAA R – CTTGGAGCTTACTAAAGGCATTCTTC P – 5'FAM – CCTGCTCCACGGCCTTGCTCTTG – 3'TAMRA; IL-12p40: F – TGAAGAAAGACGTTTATGTTGTAGAATTG, R – TGGTCCAAGGTCCAGGTGAT, RNA isolation and ... forward and reverse PCR primers were SIVgagF AGTACGGCTGAGTGAAGGCAGTA and SIVgagR GACCCGCGCCTTTATAGGA, respectively The fluorogenic SIVgag probe CGGCAGGAACCAACCACGACG was modified with FAM/TAMRA...
  • 14
  • 211
  • 0
The role of the n terminal extension domain of vamp4 in the regulation of its recycling to the TRANS GOLGI network

The role of the n terminal extension domain of vamp4 in the regulation of its recycling to the TRANS GOLGI network

Thạc sĩ - Cao học

... xii Abreviations ACTH : Adrenocorticotropic hormone ADP : Adenosine diphosphate Ala : Alanine (A) AP : Adaptor protein complex APP : Amyloid precursor protein Arf : ADP-ribosylation factor Arg ... Syntaxin 18 Syntaxin 19 Syntaxin 20 Syntaxin 21 SNAP-23 SNAP-25 SNAP-29 Type Qa Qa Qa Qa Qa Qc Qa Qc Qc Qa Qa Qa Qa Qa Qa Qa Qa Qb and Qc Qb and Qc Qb and Qc TM domain Yes Yes Yes Yes Yes Yes Yes Yes ... List of mammalian SNAREs Name Syntaxin Syntaxin Syntaxin Syntaxin Syntaxin Syntaxin Syntaxin Syntaxin Syntaxin 10 Syntaxin 11 Syntaxin 13 Syntaxin 16 Syntaxin 17 Syntaxin 18 Syntaxin 19 Syntaxin...
  • 232
  • 485
  • 0
Báo cáo y học:

Báo cáo y học: "Anticancer Activity of the PR Domain of Tumor Suppressor RIZ1"

Y học thưởng thức

... under a microscope At least 100 cells were counted for each treatment Statistical analysis was performed using GraphPad InStat (GraphPad Software, San Diego, California, USA) Anticancer activity ... folds at stage III in prostate cancer (Fig 1) Because cancer undergoes metastasis and spreads to other organs at late stages, we speculated that RIZ1 might play an important role in tumor metastasis, ... small sample size associated with the panel (n=12 for each cancer type) precluded a complete analysis, one that must await a larger scale screening study Nonetheless, we have gleaned valuable information...
  • 7
  • 467
  • 0
Tài liệu Báo cáo khoa học: Role of the cag-pathogenicity island encoded type IV secretion system in Helicobacter pylori pathogenesis pptx

Tài liệu Báo cáo khoa học: Role of the cag-pathogenicity island encoded type IV secretion system in Helicobacter pylori pathogenesis pptx

Báo cáo khoa học

... effectors across the basolateral membrane (Fig 1) A possible scenario is that early exposed cagPAI-independent factors such as the H pylori adhesins, as well as HtrA, VacA, OipA and others, may loosen ... intercellular epithelial junctions at locally restricted areas before a limited number of bacteria gain access to integrins and inject CagA The basal injection model of CagA can also explain why ... target cells with wild-type H pylori, isogenic cagA and cagPAI mutants, as well as CagA transfection For example, it was shown that, under certain circumstances, CagA can also induce the transcription...
  • 13
  • 866
  • 0
Tài liệu Rethinking the Role of the State in Finance doc

Tài liệu Rethinking the Role of the State in Finance doc

Ngân hàng - Tín dụng

... Consolate Rusagara, Andre Ryba, David Scott, James Seward, Sophie Sirtaine, Constantinos Stephanou, Mark Stone, Vijay Tata, Marilou Uy, S Kal Wajid, Juan Zalduendo, Laura Zoratto, and participants ... Gerken, Swati Ghosh, David Gould, Neil Gregory, Mario Guadamillas, Pankaj Gupta, Mary Hallward-Driemeier, Darrin Hartzler, Richard Hinz, Mustafa Zakir Hussain, Sujit Kapadia, Isfandyar Khan, Thomas ... Tata, Gerardo Corrochano, Janamitra Devan, Klaus Tilmes, Loic Chiquier, Marialisa Motta, Pierre Guislain, Sujata Lamba, Tilman Ehrbeck, and Tunc Uyanik) as well as the World Bank–International...
  • 220
  • 609
  • 0
Tài liệu Báo cáo khoa học: An autoinhibitory effect of the homothorax domain of Meis2 ppt

Tài liệu Báo cáo khoa học: An autoinhibitory effect of the homothorax domain of Meis2 ppt

Báo cáo khoa học

... NJ, USA) The GBD antibody was from Cell Signaling 10 RT-PCR RNA was isolated and purified using an Absolutely RNA kit (Agilent, Santa Clara, CA, USA) For quantitative RT-PCR, cDNA was generated ... (Gal)5-TATA luciferase reporter (A) , or the (Gal)5-SV40 reporter (B) Luciferase activity was assayed after 48 h, and is presented as the mean + standard deviation of duplicate transfections (arbitrary ... nuclear ⁄ cytoplasmic localization of Prep1, and possibly of other Meis paralogs, may play a role in regulating transcriptional activity, but it appears that the Hth domain does not maintain the...
  • 14
  • 753
  • 0
Tài liệu Báo cáo khoa học: Crystal structure of the catalytic domain of DESC1, a new member of the type II transmembrane serine proteinase family pptx

Tài liệu Báo cáo khoa học: Crystal structure of the catalytic domain of DESC1, a new member of the type II transmembrane serine proteinase family pptx

Báo cáo khoa học

... growth factors and proteinase inhibitors Biol Chem 380, 473–483 Kataoka H, Uchino H, Asada Y, Hatakeyama K, Nabeshima K, Sumiyoshi A & Koono M (1997) Analy- Crystal structure of the catalytic domain ... most favored and favored regions of the Ramachandran ˚ plot and r.m.s.d values for bond and angle of 0.005 A and 1.37 ° as shown in Table References Table Data collection and refinement statistics ... Purification and characterization of a complex containing matriptase and a Kunitz-type serine protease inhibitor from human milk J Biol Chem 274, 18237–18242 Shimomura T, Denda K, Kitamura A, Kawaguchi...
  • 13
  • 588
  • 0
Tài liệu Báo cáo khoa học: A tyrosinase with an abnormally high tyrosine hydroxylase/dopa oxidase ratio Role of the seventh histidine and accessibility to the active site docx

Tài liệu Báo cáo khoa học: A tyrosinase with an abnormally high tyrosine hydroxylase/dopa oxidase ratio Role of the seventh histidine and accessibility to the active site docx

Báo cáo khoa học

... Omura S, Ikeda H, Ishikawa J, Hanamoto A, Takahashi C, Shinose M, Takahashi Y, Horikawa H, Nakazawa H, Osonoe T, et al (2001) Genome sequence of an industrial microorganism Streptomyces avermitilis: ... tyrosinase from Rastonia solanacearum environmental pH, may also affect the expression of the most appropriate enzyme Apart from the physiological roles and environmental advantages of having several ... tyrosinase gene Mepa J Bacteriol 175, 5403–5410 11 Lopez-Serrano D, Sanchez-Amat A & Solano F (2002) Cloning and molecular characterization of a SDSactivated tyrosinase from Marinomonas mediterranea...
  • 14
  • 849
  • 0
Tài liệu Báo cáo khóa học: The PAS fold A redefinition of the PAS domain based upon structural prediction ppt

Tài liệu Báo cáo khóa học: The PAS fold A redefinition of the PAS domain based upon structural prediction ppt

Báo cáo khoa học

... P39272 233–339 PFAM PAC NA NA NA NA NA NA NA NA NA NA PAC PAC PAC PACa PAC PAC PAC PAC PAC PAC PAC PAC PAC NA NA B_19516 PROSA z-score (best model) z-Score after Align-2D (best model) )6.04 3PYP ... contain a PAC motif, and conversely that all PACannotated A thaliana proteins contain a PAS domain Therefore, in the case of A thaliana, the PAS and PAC motifs are inseparable, indicating that the annotation ... 95–201 NA P30663 36–144 P30663 162–268 PAC NA B_39296 B_39648 B_39648 NA NA PAC PAC NA B_66903 NA NA NA PACa NA B_66903 NA NA NA PACa NA PAC NA PROSA z-score (best model) z-Score after Align-2D...
  • 11
  • 592
  • 0
Tài liệu Báo cáo khoa học: The role of the ESSS protein in the assembly of a functional and stable mammalian mitochondrial complex I (NADH-ubiquinone oxidoreductase) pptx

Tài liệu Báo cáo khoa học: The role of the ESSS protein in the assembly of a functional and stable mammalian mitochondrial complex I (NADH-ubiquinone oxidoreductase) pptx

Báo cáo khoa học

... follows: anti-porin from Calbiochem, anti-HA from Covance BabCo, anti-mouse and anti-rabbit secondary antibodies from Bio-Rad Laboratories and Amersham Pharmacia Biotech, respectively Antibodies against ... membranes Anti-HA and anti-porin sera were used at : 5000 dilution whereas the anti-MWFE and anti-18 kDa sera were used at : 1000 dilution Horseradish peroxidase-conjugated secondary antibodies (anti-rabbit ... with available antisera [anti-51 kDa, anti-TYKY, anti-30 kDa, anti-18 kDa (NDUFB6)] failed to reveal the presence of any complex I-specific subunits at that position We believe that the band may...
  • 9
  • 622
  • 0

Xem thêm