a novel fpga fuel cell system controller design
Tài liệu A systematic computer-aided approach to cooling system optimal design in plastic injection molding docx
... have beenmade on the mold cooling analysis. There are mainly twoapproaches considered for the mold cooling analysis: cycle-averaged approach and transient approach.In cycle-averaged approach, ... performance of the cooling system, a moreaccurate transient analysis can enhance the unde rstandingof shrinkage and warpage of the plastic part. Hu et al. [11]adopted the dual reciprocity boundary ... integrating the cooling analysis and optimizationprograms into the design process. Using such a tool, a design can be improved systematically, automatically and efficiently.The analysis of heat...
- 10
- 1,292
- 2
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... DNA poly-merase was purchased from Toyobo (Osaka, Japan). Emul-gen 911 was a gift from Kao Chemical (Tokyo, Japan).NADPH, NADH and NADP+were purchased fromOriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamicacid ... Tmvalue of each protein at neutralpH. a Data from this study.bData from Griffin et al. [32].cData fromYano et al. [4].T. Mandai et al. Thermostable electron transport system FEBS Journal...
- 14
- 617
- 0
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx
... (Applied Biosystems). Primers for methylated DNAwere: 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ ... 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells subjected to the caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspaseassay ... Boston, MA, USA). Cell proliferation assayFor the cell proliferation assay, cells were seeded on the96-well plates, transfected using FuGENE 6 according tothe manufacturer’s manual, and incubated...
- 12
- 613
- 0
Tài liệu Báo cáo khoa học: KIPase activity is a novel caspase-like activity associated with cell proliferation doc
... units.Caspases and inhibitorsCaspase substrates and their inhibitors were purchased fromBiomol. Ac-DEVD-AMC is a substrate for caspases 3and 7; Ac-YVAD-AMC is a substrate for caspase 1;Ac-IETD-AMC ... is a substrate for caspase 8 and 10;Ac-LEHD-AMC is a substrate for caspases 2, 4, 5 and 9.Ac-DVPD-AMC, Ac-DPSD-AMC and Ac-ESQD-AMCare tetra peptide substrates representing mdm-2, p27KIP1and ... Identification ofparacaspases and metacaspases: two ancient families of caspase-like proteins, one of which plays a key role in MALT lymphoma.Mol. Cell 6, 961–967.Ó FEBS 2004 KIPase – a novel caspase-like...
- 8
- 442
- 0
Báo cáo khoa học: Gc recruitment system incorporating a novel signal amplification circuit to screen transient protein-protein interactions pot
... primers 5¢-AAATATAAAACGCTAGCGTCGACATGGCGC-3¢ and 5¢-AGCGTAAAGGATGGGGAAAG-3¢. The final ratio of targetcells was determined by counting the number of coloniesretaining the target genes.AcknowledgementsThis ... yeasttwo-hybrid system. Mol Cell Biochem 172, 67–79.8 Takesako K, Ikai K, Haruna F, Endo M, ShimanakaK, Sono E, Nakamura T, Kato I & Yamaguchi H(1991) Aureobasidins, new antifungal antibiotics.Taxonomy, ... we have established a powerfulapproach to screen weak and transient protein–proteininteractions by incorporating a novel signal amplifica-tion circuit with intact Gc as an artificial signal ampli-fier...
- 9
- 536
- 0
Báo cáo khoa học: Effects of a novel arginine methyltransferase inhibitor on T-helper cell cytokine production pot
... Purandare AV, Chen Z, Huynh T, Pang S, Geng J,Vaccaro W, Poss MA, Oconnell J, Nowak K & Jayar-aman L (2008) Pyrazole inhibitors of coactivator associ-ated arginine methyltransferase 1 (CARM1). ... demonstratedselectivity for the PRMTs, although AMI-6 was mini-mally active against a cellular PRMT substrate [8].Computational modeling suggested that AMI-1 spansthe SAM-binding and arginine-binding ... Proliferation assays were performedusing the CellTiter 96 Aqueous One Solution ProliferationAssay reagent (Promega, Madison, WI, USA).Plasmids, transfections and luciferase assaysGST–PRMT1 and GST–CARM1...
- 13
- 646
- 0
Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx
... 5¢-CTAGACTCGAGCCTAATTTATATTTGCTCCTTGTGC-3¢. b-Actin primers weredesigned as follows: forward 5¢-CTACAATGAGCTGCGTGT-3¢ and reverse 5¢-AAGGAAGGCTGGAAGAGT-3 ¢. Cell survival and apoptosis analysisFor viability ... theyeast two-hybrid assay and using a mammalian hybrid system (Invitrogen, Carlsbad, CA) (EDA Wheeler &V Ayyavoo, unpublished data). A blast searchrevealed that the IMAGE clone, localized ... variant ofANKHD1 and may play a role in cellular apoptosis (antiapoptotic) and cell survival pathway(s).AbbreviationsANK, ankyrin repeat motif; ANKHD1, ankyrin repeat and KH domain 1; DMEM, Dulbecco’s...
- 12
- 561
- 0
Báo cáo khoa học: Construction of a novel detection system for protein–protein interactions using yeast G-protein signaling pdf
... TCATCTTTTAAACTTTGGGCGAAGGCGTTT23 TTTTCTCGAGAAAGATGCCGATTTGGGCGC24 GGGGCTCGAGGTTTTATATTTGTTGTAAAA25 ATATTATATATATATATAGGGTCGTATATA26 AAATTATAGAAAGCAGTAGA TAAAACAATG27 CTTCGAAGAATATACTAAAAAATGAGCAGGCAAGATAAACGAAGGCAAAGTTCAATTCATCATTTTTTTTTTATTCTTTT28 ... GCCCGGATCCTGATAGTAATAGAATCCAAA4 CCCCGAATTCAAATTATAGAAAGCAGTAGA5 AAGGCTCGAGAGATCTGTTTAGCTTGCCTC6 AAAAGTCGACGAGCTCGTTTTCGACACTGG7 TTTTGTCGACATGGCGCAACACGATGAAGCCGTAGACAAC8 GGGGGGATCCTTACATAAGCGTACAACAAACACTATTTGATTTCGGCGCCTGAGCATCATTTAGCTTTTT9 ... TTTTGTCGACATGGCGCAACACGATGAAGCCGTAGACAAC18 GGGGGGATCCTTACATAAGCGTACAACAAACACTATTTGATTTCGGCGCCTGAGCATCATTTAGCTTTTT19 ATCCAAAGTTTAGCCGATGACCCAAGCCAA20 TTGGCTTGGGTCATCGGCTAAACTTTGGAT21 AAACGCCTTCGCCCAAAGTTTAAAAGATGA22 TCATCTTTTAAACTTTGGGCGAAGGCGTTT23...
- 9
- 444
- 0
Ruta 6 selectively induces cell death in brain cancer cells but proliferation in normal peripheral blood lymphocytes: A novel treatment for human brain cancer doc
... (P.B. and P.B.) have used Ruta 6 and Ca3(PO4)2combination therapy to treat 15 patients diagnosed withadvanced intracranial malignant brain cancer at the PBHResearch Foundation, Kolkata, ... intracranial brain cancers.The 15 patients (9 male, 6 female) with intracranial braincancers who were treated with Ruta 6 + Ca3(PO4)2at thePBH Research Foundation, Kolkata, India, had ... fragmentation of DNA, leadingto cell death; h) FACS analysis indicates that Ruta induces cell death in a dose- and duration-dependent manner inhuman MGR1 brain cancer cells, followed by saturationeffects....
- 8
- 670
- 0
Báo cáo khoa học: A novel pathway for sequential transformation of 7-dehydrocholesterol and expression of the P450scc system in mammalian skin pptx
... ATTAAGGAGCTTCGGGAGATG Exon 7 380P558 CTCTTATACCCAATGCTGCTG Exon 10CYP1 1A First pairP561 GCCTTTGAGTCCATCACTAAC Exon 4 628P562 CCAGTGTCTTGGCAGGAATC Exon 8Nested pairP563 ATGTGGCTGCATGGGACGTG ... controlplacenta, whole human skin, normal epidermal and immor-talized keratinocytes, dermal fibroblasts, squamous cell carcinoma and five human melanomas. Thus, these dataclarify in detail the cutaneous ... specimens,subcutaneous adip ose tissue, epidermal and dermal cell lines[normal epidermal keratinocytes, immortalized keratino-cytes (HaCaT), dermal fibroblasts, squamous cell carci-noma, five human melanomas...
- 11
- 475
- 0
Báo cáo Y học: Isolation and characterization of MUC15, a novel cell membrane-associated mucin pot
... nodec–+dND a Primer pair: 5¢-AATACCAAAGAAGCCTACAATG-3¢ and 5¢-GTACGAAGTGGAGGTATGTCATC-3¢.bPrimer pair: 5¢-GCCATTTTAGGTGCTATTCTGG-3¢ and 5¢-TATTTTCTTTATCTGAGTTTA-3¢.cPrimer pair: 5¢-CATCCATAGCAGATAACAGTC-3¢ ... Specific forward andreverse primers were designed to produce a PCR product of513 bp containing the transmembrane domain: 5¢-CATCCATAGCAGATAACAGTC-3¢ (forward) and 5¢-TCCCAAAGCTCATGTCATAAG-3¢ (reverse) ... Two alternativepoly (A) signals [A( 1259)TAAA and A( 1430)ATTAAA]giving rise to poly (A) tails were observed by PCR-screeningof the bovine mammary gland cDNA library.The N-terminal amino-acid...
- 9
- 614
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 sự cần thiết phải đầu tư xây dựng nhà máy từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008