a hybrid neural fuzzy system for statistical process control
Tài liệu A Hybrid Neural Fuzzy System for Statistical Process Control docx
... A Hybrid Neural Fuzzy System for Statistical Process Control 18.1 18.2 18.3 18.4 Shing I Chang Kansas State University Statistical Process Control Neural Network Control Charts A Hybrid Neural ... alternative statistical process control method for monitoring process mean and variance A hybrid neural fuzzy system consists of four modules for data input, data processing, decision making, and data ... first statistical control charts for monitoring process variance changes Johnson and Leone (196 2a, 1962b) and Page (1963) later proposed CUSUM charts based on sample variance and sample range As an...
- 22
- 716
- 1
PERFORMANCE OF A COMBINED CONSTRUCTED WETLAND SYSTEM FOR TREATING VILLAGE SEWAGE IN LAKE DIANCHI VALLEY
... the pollutants concentration was low in the rain season (from May to October) The data from the local weather station showed that the average annual rainfall and evaporation was 802mm and 2093mm, ... order to make full use of the land advantage to strengthen ecological and scenical effect of ecological system The area was 2000 m2 and hydraulic loading rate was 4cm/d in the free-surface constructed ... domestic wastewater in Lake Dianchi Valley., Proceedings of Asian waterqual’2003, IWA Asia-Pacific Regional conference, Abstract on pp 70, Paper on CD-ROM, Bangkok Liu, C.X., Hu, H.-Y., Huang, X.,...
- 8
- 450
- 0
A distributed decision support system for building evacuation 2009
... translated in a full knowledge of the building graph and a calculation of the shortest paths by using Dijkstra’s algorithm An evacuee becomes aware of a hazardous area when it reaches a location ... hazard A low value indicates that the system has succeeded in directing the evacuees along safe paths, avoiding the hazardous locations • Percentage of fatally injured evacuees This is a straightforward ... building’s structure before the hazard starts spreading We consider that the evacuees are familiar with all the available exits and are able to follow the shortest paths that lead to them In terms...
- 8
- 409
- 0
PROBE–A multicriteria decision support system for portfolio robustness evaluation
... Analysis with Spreadsheets Duxbury Press, Belmont, CA Kleinmuntz, C.E., Kleinmuntz, D.N., 1999 A strategic approach to allocating capital in healthcare organizations Healthcare Financial Management, ... multicriteria value analysis and decision conferencing: A case study International Transactions in Operational Research, 13(4), 279-297 Bana e Costa, C .A. , Lourenço, J.C., Soares, J.O., 2007 An interval ... References Bana e Costa, C .A. , 1990 An additive value function technique with a fuzzy outranking relation for dealing with poor intercriteria preference information In C .A Bana e Costa, ed Readings...
- 26
- 372
- 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK *****::*.** : ... Toyobo (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic acid was obtained from ... :.:: : * : * NAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKA-EFQGK-RVLIVGGGDS -EYTCDALIIATGASA -RYLGLPSEEAFKGRGVSACATCDG-FFYRNQKVAVIGGGNT LEVKARTVILAVGSRR -RKLGVPGEAELAGRGVSYCSVCDAPLFKGKDAVVVVGGGDS...
- 14
- 617
- 0
Tài liệu Báo cáo khoa học: "MemeTube: A Sentiment-based Audiovisual System for Analyzing and Displaying Microblog Messages" pdf
... We also integrate the sentiment-detection system with a real-time rule-based harmonic music and animation generator to display streams of messages in an audiovisual format Conceptually, our system ... similar to what many people have proposed for evaluation (Davidov et al 2010; Sun et al 2010; Bifet and Frank 2010; Go et al 2009; Pak and Paroubek 2010; Chen et al 2010) We use data from January ... playing Animation Generation In this final stage, our system produces real-time animation for visualization The streams of messages are designed to flow as if they were playing a piece of a piano...
- 6
- 449
- 0
Tài liệu Báo cáo khoa học: "A Hybrid Convolution Tree Kernel for Semantic Role Labeling" pptx
... Pradhan, Kadri Hacioglu, Valeri Krugler, Wayne Ward, James H Martin, and Daniel Jurafsky 200 5a Support vector learning for semantic argument classification Machine Learning Journal Nello Cristianini ... PAF 64.38 Linear 68.71 Poly 70.25 Development Test WSJ Test Brown Table 3: Performance (Fβ=1 ) comparison among various kernels Test WSJ Overall A0 A1 A2 A3 A4 A5 AM-ADV AM-CAU AM-DIR AM-DIS AM-EXT ... standard features, we can see that the syntactic features, such as Path, Path Length, bulk large among all features On the other hand, the previous researches (Gildea and Palmer, 2002; Punyakanok...
- 8
- 390
- 0
Báo cáo khoa học: "A Broad-Coverage Normalization System for Social Media Language" pot
... normalization problem was also tackled under the machine transla- tion (MT) or speech recognition (ASR) framework (Aw et al., 2006) adapted a phrase-based MT model for normalizing SMS and achieved ... SMS and Twitter data sets to evaluate the system effectiveness Statistics of these data sets are summarized in Table Data set (1) to (3) are used for word-level evaluation; data set (4) for both ... that the broad-coverage system outperforms all other systems on the reported data sets It achieves about 90% word-level accuracy on data set (1) and (2) with the top-10 candidates (an average...
- 10
- 845
- 0
Báo cáo khoa học: "A Modular Open-Source System for Recognizing Textual Entailment" pot
... of each step and the final score For each transformation the tool presents the parse tree before and after applying the transformation, highlighting the impact of this transformation In manual ... Semantic inference at the lexicalsyntactic level In Proceedings of AAAI Luisa Bentivogli, Peter Clark, Ido Dagan, Hoa Dang, and Danilo Giampiccolo 2010 The sixth pascal recognizing textual entailment ... Manning 2005 Incorporating non-local information into information extraction systems by gibbs sampling In Proceedings of ACL Yoav Goldberg and Michael Elhadad 2010 An efficient algorithm for easy-first...
- 6
- 414
- 0
Báo cáo khoa học: "A Multi-Document Summarization System for Scientific Article" docx
... user a multi-document summary typical evaluation of a multi-document summarization system, gold standard summaries are created by hand and then compared against fixed length generated summaries ... domain of scientific article summarization, we used a widely used and freely available multi-document summarization system called MEAD (Radev, 2004) as our baseline MEAD uses centroid based summarization ... extraction, utility based evaluation, and user studies In NAACL-ANLP 2000 Workshop on Automatic summarization, pages 21-30, Morristown, NJ, USA [12, 16, 17] Radev, Dragomir 2004 MEAD - a platform...
- 6
- 343
- 0
Báo cáo khoa học: "A Hierarchical Phrase-Based Model for Statistical Machine Translation" pptx
... Byrne 2005 A weighted finite state transducer translation template model for statistical machine translation Natural Language Engineering To appear 270 Ying Zhang, Stephan Vogel, and Alex Waibel 2004 ... Southern California Kenji Yamada and Kevin Knight 2001 A syntax-based statistical translation model In Proceedings of the 39th Annual Meeting of the ACL, pages 523–530 Philipp Koehn 200 4a Pharaoh: a ... translation We compared a baseline system, the state-of-the-art phrase-based system Pharaoh (Koehn et al., 2003; Koehn, 200 4a) , against our system For all three systems we trained the translation...
- 8
- 331
- 0
NiagaraCQ: A Scalable Continuous Query System for Internet Databases ppt
... demonstrate in Section 4, very scalable NIAGARACQ COMMAND LANGUAGE NiagaraCQ defines a simple command language for creating and dropping continuous queries The command to create a continuous query has ... contains a brief discussion of the caching mechanisms in NiagaraCQ to make the system more scalable NiagaraCQ is the continuous query sub -system of the Niagara project, which is a net data management ... 4.1 System Architecture Figure 4.1 shows the architecture of Niagara system NiagaraCQ is a sub -system of Niagara that handles continuous queries NiagaraCQ consists of A continuous query manager,...
- 12
- 425
- 0
Báo cáo khoa học: "A Discriminative Latent Variable Model for Statistical Machine Translation" pdf
... 160–167, Sapporo, Japan Slav Petrov, Adam Pauls, and Dan Klein 2007 Discriminative log-linear grammars with latent variables In Advances in Neural Information Processing Systems 20 (NIPS), Vancouver, ... the NAACL (HLT-NAACL 2003), pages 134–141, Edmonton, Canada Christoph Tillmann and Tong Zhang 2007 A block bigram prediction model for statistical machine translation ACM Transactions Speech Language ... Natural Language Processing (EMNLP-2007), pages 737–745, Prague, Czech Republic Taro Watanabe, Jun Suzuki, Hajime Tsukada, and Hideki Isozaki 2007 Online large-margin training for statistical...
- 9
- 291
- 0
iCare: A Mobile Health Monitoring System for the Elderly pptx
... personal health information system and the medical guidance 1) Personal health information system: The personal health system can store physiological data and other information in the database ... 2) Data processing: Data processing module is to process data depending on different categories of data which are get from data receiving module and take related action For physiological data, ... system can act as the personal health information system on the server The smart phone gets physiological data from sensors, and locally stores physiological data and other information such as...
- 7
- 572
- 0
Báo cáo khoa học: "A Discriminative Global Training Algorithm for Statistical MT" potx
... in common phrase-based translation systems: for them it has been shown that good translation performance can be achieved A systematic analysis of the novel training algorithm will allow us to ... Đ update update (*) k select relevant points for each data point ắ k for each decoding iteration : and alternative initialize truth p for each data point mal statement here A detailed ... performance of phrasebased translation systems (Chiang, 2005; Och, 2003), this paper presents a novel block sequence translation approach to SMT that is similar to sequential natural language annotation...
- 8
- 278
- 0
Báo cáo sinh học: "Comparisons of three polyethyleneimine-derived nanoparticles as a gene therapy delivery system for renal cell carcinoma" doc
... Sugiyama A, Kume H, Ota S, Kashima T, Tomita K, Kitamura T, Kodama T, Fukayama M, Aburatani H: Identification of Toll-like receptor as a potential therapeutic target in clear cell renal cell carcinoma ... dissolve the MTT-formazan crystals The absorbance was measured at 490 nm by an ELISA microplate reader (Bio-Rad) Besides that, the toxicity on Ana-1 and HUVEC cells were evaluated with the same method ... physic-chemical properties (size and charge) of each separate material, including PCFC-g-PEI and FA-PEAs, as well as the FA-PEAs: pVHL complexes Because PCFC-g-PEI and FA-PEAs are amphiphilic...
- 10
- 453
- 0
báo cáo hóa học:" Comparisons of three polyethyleneimine-derived nanoparticles as a gene therapy delivery system for renal cell carcinoma" pot
... Sugiyama A, Kume H, Ota S, Kashima T, Tomita K, Kitamura T, Kodama T, Fukayama M, Aburatani H: Identification of Toll-like receptor as a potential therapeutic target in clear cell renal cell carcinoma ... dissolve the MTT-formazan crystals The absorbance was measured at 490 nm by an ELISA microplate reader (Bio-Rad) Besides that, the toxicity on Ana-1 and HUVEC cells were evaluated with the same method ... physic-chemical properties (size and charge) of each separate material, including PCFC-g-PEI and FA-PEAs, as well as the FA-PEAs: pVHL complexes Because PCFC-g-PEI and FA-PEAs are amphiphilic...
- 10
- 306
- 0
Báo cáo hóa học: "Research Article Design of a Versatile and Low Cost μVolt Level A to D Conversion System for Use in Medical Instrumentation Applicatio" pdf
... the case of a hand-held instrument, allows for a “snapshot” of the data stream to be made manually at a time chosen by the operator Use of this additional facility does not interrupt the data stream ... digital format has occurred Achieving reliable analogue amplification and filtering at the ultra low sensor outputs encountered proved to be unproductive in that every analogue stage produced and added ... and furnishes a compact and low cost method for the capture and integrated digital processing of measurement data in a range of situations including clinical diagnostic and treatment venues The...
- 6
- 391
- 0
Báo cáo hóa học: "A Reconfigurable FPGA System for Parallel Independent Component Analysis" pot
... Cohen and A G Andreou, “Analog CMOS integration and experimentation with an autoadaptive independent component analyzer,” IEEE Transactions on Circuits and Systems II: Analog and Digital Signal Processing, ... Data ram Clock (a) Read in process w1 in Output process Decorrelation process w1 out Data ram 16 DEC Data ram NORM Data ram 16 CMP Counter Counter MUL w2 in ADD Counter Data ram Data ram 16 Clock ... of nongaussianity since Gaussian variable has the largest entropy among all random variables of equal variance [16] Because it is difficult to calculate negentropy, an approximation is usually given...
- 12
- 286
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam nội dung cụ thể cho từng kĩ năng ở từng cấp độ phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008