1—conversion of core strengths to equivalent in place strengths
guide for obtaining cores and interpreting compressive strength results
... 214.4R-9 8 .1—Conversion of core strengths to equivalent in- place strengths 8.2—Uncertainty of estimated in- place strengths 8.3—Percentage of in- place strengths less than fc′ 8.4—Methods to estimate ... range of core strengths due to single-operator error Number of cores Expected range of core strength as % of average core strength Range with 5% chance of being exceeded as % of average core strength ... evaluating the strength capacity of an existing structure using in- place strengths As noted in Chapter 2, the strength of concrete in a placement usually increases with depth In single-story columns,...
- 16
- 296
- 0
Báo cáo hóa học: " Confined conversion of CuS nanowires to CuO nanotubes by annealing-induced diffusion in nanochannels" ppt
... conditions, leading to the formation of nanoparticles instead of nanotubes [20,21] Thus, the spreading of CuO and formation of CuO layer on the nanochannel surface of AAO and the confinement offered ... well with those of the pores of the AAO template used, indicating fine confinement of the template pores Figure 2b gives a SEM top view of the CuS nanowire array after partly dissolving the AAO pore ... surface of AAO template, further spreading of CuO would become possible, which would eventually result in the formation of CuO nanotubes To examine this hypothesis for the formation mechanism of CuO...
- 6
- 285
- 0
An investigation into some types of verbal responses to questions in English and Vietnamese conversation
... source to gain some significant insights in pragmatic strategies of responding acts, the situations are designed to investigate socio- 22 cultural factors including the decision of using different ... linguists pay much attention to initiating acts: requesting, complimenting, complaininghowever, the studies of responses are less mentioned Although we meet much difficult to find references to ... act of saying something in the full sense of say Illocutionary act: the act performed in saying something Perlocutionary act: the act performed by or as a result of saying For instance, in a...
- 42
- 1,062
- 4
Harvesting, oil extraction, and conversion of local filamentous algae growing in wastewater into biodiesel
... sources of biofuel feedstocks The benefits of using filamentous macroalgae as feedstocks include: (i) simplicity of harvesting by scraping or screen filtration; (ii) their potential to grow in wastewater ... depending on the season, chlorinated, dechlorinated, and then discharged Figure is a photograph of the algae growing in the launders The algae are a combination of several coexisting species including ... blending All runs were conducted at full loading and 2500 rpm with a 13.4-kW, inline, three-cylinder, direct-injection diesel engine To load the engine, a dynamometer is coupled to the rotating...
- 6
- 488
- 0
A study of semantic and syntactic features of idioms relating to fruits in english and vietnamese
... used in the meaning transfer of 140 100% 140 100% idioms In fact, metaphor is the concept of understanding one thing in 4.3 SIMILARITIES AND DIFFERENCES IN SEMANTIC terms of another Interestingly, ... condition and history relating to idioms to understand them better Besides, learners also should pay attention to transfer meaning in process of translating idioms To master endless source of idioms, ... phenomena to express the abstract sense thanks to the means of metaphor, simile 0% 0% In the same transference of meaning of metaphor, “Metaphor is the transference of meaning (name) from one object to...
- 13
- 1,304
- 8
Alternate strategies for conversion of waste plastic to fuels
... government of India, import data of more than 59,000 tons and 61,000 tons of plastic waste have found its way into India in the years 1999 and 2000, respectively [3, 6] 2.1 Present Scenario in India ... http://www.hindawi.com Engineering Journal of Volume 2013 ISRN Mechanical Engineering Hindawi Publishing Corporation http://www.hindawi.com Hindawi Publishing Corporation http://www.hindawi.com ... is incinerated Generation of the heat energy is the only advantage of this process The residual of this incineration has 20wt%, respectively, 10 vol% of the original waste and are placed in landfills...
- 8
- 537
- 0
Tài liệu Báo cáo khoa học: "Robust Conversion of CCG Derivations to Phrase Structure Trees" pdf
... treebank In Proceedings of the 7th International Workshop on Treebanks and Linguistic Theories, pages 159–170 Fei Xia 1999 Extracting tree adjoining grammars from bracketed corpora In Proceedings of ... each combinator that combine instructions Figure shows a typical instruction, which specifies the node to create and where to place the PTB trees associated with the two categories combining More ... discriminative reranking In Proceedings of ACL, pages 173–180 David Chiang 2000 Statistical parsing with an automatically-extracted tree adjoining grammar In Proceedings of ACL, pages 456–463 Stephen...
- 5
- 492
- 0
The Economic Effects of Restricted Access to Land in the West Bank ppt
... regulations, including difficulty in obtaining an official land title, risk of confiscation, near systematic denial of permit requests and threat of demolitions, combine to maintain a high level of insecurity ... price of Palestinian products in Palestine was 76% of the price of Israeli products in 2002, and increased to 95% in 2005 65 43 Today, the constraints on the agriculture sector are overwhelming ... surrounding towns and villages A number of these projects, indeed those most critical to maintaining and improving the living conditions and level of municipal services to the area, are constrained...
- 48
- 529
- 0
The Economic Effects of Restricted Access to Land in the West Bank pdf
... regulations, including difficulty in obtaining an official land title, risk of confiscation, near systematic denial of permit requests and threat of demolitions, combine to maintain a high level of insecurity ... price of Palestinian products in Palestine was 76% of the price of Israeli products in 2002, and increased to 95% in 2005 65 43 Today, the constraints on the agriculture sector are overwhelming ... surrounding towns and villages A number of these projects, indeed those most critical to maintaining and improving the living conditions and level of municipal services to the area, are constrained...
- 48
- 598
- 0
Báo cáo lâm nghiệp: "An analysis of ecophysiological responses to drought in American Chestnut" ppt
... Wisconsin (lat 43◦ 32’; long 90◦ 1’) Containerized seedlings were established by direct seeding into 3.7 L plastic pots containing a standard glasshouse potting substrate mixture of peat moss, pine ... years in Trenton, SC, shipped to Clemson, SC, and transplanted at × m spacing at the Clemson Forest Operations Laboratory in the spring of 2002 To simulate a natural planting but protect seedlings ... of the blight fungus [16] Interestingly, post blight populations of American chestnut exist mostly in the understory of xeric slope hardwood forests [16] Thus, a more in depth understanding of...
- 10
- 302
- 0
Enhancement of tolerance development to morphine in rats prenatally exposed to morphine, methadone, and buprenorphine docx
... average of body weight in all of the opioid treated groups Prenatal exposure to morphine enhanced the rate of tolerance development to morphine in the offspring However, development of tolerance to ... AUC of rats after receiving first injection of buprenorphine (B) The latency and AUC of rats after receiving 4th injection of buprenorphine (C) Rate of tolerance development to buprenorphine in ... development of tolerance to morphine in prenatally methadone- and morphine-exposed offspring The morphine-induced tolerance in prenatally methadone-exposed animals might also be due to opioid receptor...
- 10
- 230
- 0
báo cáo khoa học: " Intein-mediated site-specific conjugation of Quantum Dots to proteins in vivo" pdf
... of QD's to Akt-PH-EGFP via intein mediated protein splicing In vivo conjugation of QD's to Akt-PH-EGFP via intein mediated protein splicing (a) Schematic representation of site-specific intein-mediated ... half of the intein (IC) was biotinylated and conjugated in vitro to streptavidin-coated QD's The RNA's encoding Akt-PH -IN or Btk-PH -IN were delivered into Xenopus embryos via microinjection together ... H-MVKVIGRRSLGVQRIFDIGLPQDHNFLLANGAIAANCFDYKDDDDK(Ahx-Biotin)G-NH2 Modifications: Biotin conjugated to lysine via a Ahx linker (6 carbon inert linker) A 47 amino acid peptide corresponding to C-terminal intein (IC) was synthesized...
- 9
- 203
- 0
Báo cáo y học: " Criterion distances and environmental correlates of active commuting to school in children" pps
... decrease in the number of children using motorized transport to go to school and an increase of active commuting, due to an increase in the number of children cycling to school in the range of 3.00 ... predictor of active commuting to school According to the present results, interventions to promote active commuting in 11- to 12-year-old children should be focusing on children living within a ... insight into this domain may be indispensable, with an eye on creating appropriate interventions to encourage active commuting in schoolchildren According to the review of Panter et al [15], one of...
- 10
- 192
- 0
Báo cáo y học: " Lineage-specific expansion of proteins exported to erythrocytes in malaria parasites" doc
... contain all three domains: the J-domain (including a highly conserved HPD motif essential for interaction of the protein with HSP70), a glycine-rich domain and a carboxy-terminal zinc-finger domain ... of 100 to 200 amino acids from the aminoterminal methionine appears to be a general rule In all the DnaJ containing members of the PHISTb subfamily, the DnaJ domain is carboxy-terminal to the ... domains In total, at least 287 of 396 exported proteins are members of families - approximately 75% of the exportome One of the major goals of this study was to determine whether a subset of exported...
- 22
- 265
- 0
Study on situation to overcome the consequences of toxic chemicals to humans in Cam Lo District, Quang Tri province
... condition; assessing the existence of doxin in environment and proposing solutions to overcome; studying the threshold of dioxin in the soil and sediment to be the basis to deal with doxin in hot spots ... Rate of labor declination of victims of toxic chemicals in communes and towns of Cam Lo district 72 Figure 2.8 Number of victims directly infected by toxic chemicals 73 Figure 2.9 Diseases of indirect ... chemicals to people; ii) Generally assessing the situation of overcoming influences of toxic chemicals; achievements and shortcomings; iii) Assessing institutional system to concerning the victims of...
- 127
- 449
- 0
Antecedents of student SI to pacificipcip in extra curricular
... decision-making According to many researches, approximately 30% of variance in intention seems to be explained by attitudinal factor, while the normative factor has less influence to intention ... drivers in some situations such as: drinking and driving; speeding; close following; and overtaking in risky curricular The findings in this study confirm the hypothesis that all of three independent ... Factor Loading: According to Hair et al (1998), factor loading is an indicator ensuring practical significance of EFA method If factor loading is equal or bigger than 0.30, it is at minimum...
- 85
- 334
- 1
thảo luận tiếng anh 1.5 VCU Topic Factors to consider in setting up a business
... likelihood of achieving success? 1.4 Who Might Be Interested in Investing in My Company? As the amount of funds needed increases, you will be required to access an increasingly sophisticated investor ... discussing: • Members read and analysed about contents of topic • Deviding many parts in order to members can find information Duties for members: • Finding information and send it to head of the ... professional investors, and are more likely to invest due to the relationship than the economics of the business proposal On the other hand, family investors bring their own set of problems, including...
- 14
- 737
- 0
Conversion of saline water to fresh water using air gap membrane distillation (AGMD)
... countries due to cheap cost of fossil fuel in that region At the end of 2002, according to IDA Desalting Inventory (2004), MSF and RO accounted for 36.5% and 47.2%, respectively, of the installed ... CHAPTER INTRODUCTION • Simulation of a multi-stage MD system utilizing waste heat from on-board ships’ engine cooling water 1.3 Scope of the thesis An introduction to membrane distillation including ... two types of polarization are the main limiting factors for MD and are the main areas of interest in the contemporary research on MD process CHAPTER INTRODUCTION 1.1.2 Classification of MD and...
- 248
- 646
- 0
Research study on the trends and patterns of corporate giving to charities in singapore
... in Giving We need to look into the real motives and purposes of corporate giving This is a challenging issue to examine and is critical to understand factors influencing giving in the field of ... rather than professionalism One surprising finding is that the Singapore sample indicated that they are not motivated by having to follow the industry or business network norms of giving, but rather ... PATTERNS OF CORPORATE GIVING TO CHARITIES IN SINGAPORE TAN BEE WAN (BA, University of Singapore, MA in Social Welfare, University of Wisconsin- Milwaukee) A DISSERTATION SUBMITTED TO THE FACULTY OF...
- 239
- 379
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản xác định thời lượng học về mặt lí thuyết và thực tế khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc các đặc tính của động cơ điện không đồng bộ đặc tuyến hiệu suất h fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy phần 3 giới thiệu nguyên liệu chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25