NGHIÊN CứU BIếN ĐổI THàNH PHầN GEN H5 CủA VIRUS CúM A/H5N1 PHÂN LậP Từ Gà HậU GIANG SO SáNH VớI CáC CHủNG CủA VIệT NAM Và VùNG ĐÔNG NAM CHÂU á (2005 - 2008)

8 493 0
  • Loading ...
1/8 trang

Thông tin tài liệu

Ngày đăng: 28/08/2013, 10:55

TÓM TẮTToàn bộ gen HA (H5) (gồm 1707 bp) của một chủng virus cúm A/H5N1 phân lập từ gà tại HậuGiang năm 2005 (ký hiệu A/Ck/Vietnam/HG4/2005) đã được thu nhận, giải trình trình tự (đăng ký Ngânhàng gen số: EF051513). Thành phần nucleotide, amino acid gen H5 của A/Ck/Vietnam/HG4/2005(H5N1)được sử dụng để phân tích và xây dựng quan hệ phả hệ giữa chủng này với một số chủng của TrungQuốc, Việt Nam và Đông Nam Á phân lập trong các năm 2005 - 2008. Kết quả phân tích và so sánh chothấy, thành phần nucleotide gen H5 của chủng A/Ck/Vietnam/HG4/2005 (Hậu Giang) có 9 vị trí sai kháchoàn toàn so với 19 chủng so sánh phân lập từ các vùng miền khác nhau của Việt Nam và châu Á. Tỷ lệđồng nhất (identity) của gen H5 về nucleotide thấp nhất là 98% và tỷ lệ tương đồng (homology) vềamino acid thấp nhất là 97% giữa chủng A/Ck/Vietnam/HG4/2005 so với các chủng virus cúm A/H5N1 từmiền Nam Việt Nam (Long An, Hậu Giang, Kiên Giang, Cà Mau và Bến Tre), Trung Quốc và Đông NamÁ, phân lập trong các năm 2005 - 2008. Chủng A/Ck/Vietnam/HG4/2005 được khẳng định cùng nguồngốc dưới dòng Quảng Đông, nhưng có thành phần gen khác nhiều so với các chủng dưới dòng PhúcKiến. Hỗn hợp virus cúm A/H5N1 gây bệnh tại Việt Nam có thể là vấn đề nên quan tâm để có phươnghướng về chẩn đoán, dịch tễ và phòng chống. Tp chớ Khoa hc v Phỏt trin 2008: Tp VI, S 6: 562-569 I HC NễNG NGHIP H NI 562 NGHIÊN CứU BIếN ĐổI THNH PHầN GEN H5 CủA VIRUS CúM A/H5N1 PHÂN LậP Từ G HậU GIANG SO SáNH VớI CáC CHủNG CủA VIệT NAM V VùNG ĐÔNG NAM CHÂU á (2005 - 2008) Genetic Analysis of HA (H5) of Influenza Virus A/H5N1 Isolated from Chicken in Hau Giang in Comparison with the Strains Isolated in Vietnam and Southeast Asian Region (2005 - 2008) Trn Quang Vui 1 , Nguyn Th Bớch Nga 2 v Lờ Thanh Ho 2 1 Trng i hc Nụng Lõm, i hc Hu 2 Vin Cụng ngh Sinh hc, Vin Khoa hc v Cụng ngh Vit Nam TểM TT Ton b gen HA (H5) (gm 1707 bp) ca mt chng virus cỳm A/H5N1 phõn lp t g ti Hu Giang nm 2005 (ký hiu A/Ck/Vietnam/HG4/2005) ó c thu nhn, gii trỡnh trỡnh t (ng ký Ngõn hng gen s: EF051513). Thnh phn nucleotide, amino acid gen H5 ca A/Ck/Vietnam/HG4/2005(H5N1) c s dng phõn tớch v xõy dng quan h ph h gia chng ny vi mt s chng ca Trung Quc, Vit Nam v ụng Nam phõn lp trong cỏc nm 2005 - 2008. Kt qu phõn tớch v so sỏnh cho thy, thnh phn nucleotide gen H5 ca chng A/Ck/Vietnam/HG4/2005 (Hu Giang) cú 9 v trớ sai khỏc hon ton so vi 19 chng so sỏnh phõn lp t cỏc vựng min khỏc nhau ca Vit Nam v chõu . T l ng nht (identity) ca gen H5 v nucleotide thp nht l 98% v t l tng ng (homology) v amino acid thp nht l 97% gia chng A/Ck/Vietnam/HG4/2005 so vi cỏc chng virus cỳm A/H5N1 t min Nam Vit Nam (Long An, Hu Giang, Kiờn Giang, C Mau v Bn Tre), Trung Quc v ụng Nam , phõn lp trong cỏc nm 2005 - 2008. Chng A/Ck/Vietnam/HG4/2005 c khng nh cựng ngun gc di dũng Qung ụng, nhng cú thnh phn gen khỏc nhiu so vi cỏc ch ng di dũng Phỳc Kin. Hn hp virus cỳm A/H5N1 gõy bnh ti Vit Nam cú th l vn nờn quan tõm cú phng hng v chn oỏn, dch t v phũng chng. T khoỏ: Cỳm A/H5N1, di dũng, HA(H5), ph h, thnh phn nucleotide/amino acid. SUMMARY The entire HA (H5) gene (1707 bp) of an avian influenza isolate collected from chicken in Hau Giang province (designated as A/Ck/Vietnam/HG4/2005) was obtained, completely sequenced (GenBank: EF051513). The nucleotide, amino acid of H5 sequence of A/Ck/Vietnam/HG4/2005(H5N1 was used to analyze for assessment of genetic variation and phylogenetic relationship with a number of strains isolated in China, Vietnam and Southeast Asia during 2005 - 2008. Results showed that the sequence of the A/Ck/Vietnam/HG4/2005 isolate (Hau Giang) had 9 nucleotides completely different from other 19 isolates of Vietnam and Asian countries compared. The identity incidence of the H5 gene of A/Ck/Vietnam/HG4/2005 was at least 98% for nucleotide and the homology incidence was at least 97% for amino acids compared with between this isolate and those strains isolated from South of Vietnam (ie. Long An, Hau Giang, Kien Giang, Ca Mau, Ben Tre provinces), China and Southeast Asia during 2005 - 2008. The A/Ck/Vietnam/HG4/2005 was confirmed to belong to the Guangdong sublineage; however, its nucleotide and amino acid composition differed from the isolates of the Fujian sublineage. The mix of A/H5N1 currently circulating in Vietnam and causing avian influenza should be an issueto be paid attention to in terms of diagnosis, epidemiology and control. Key words: Avian influenza A/H5N1, composition of nucleotide/amino acids, HA(H5), phylogeny, sublineage. Nghiờn cu bin i thnh phn gen H5 ca virus cỳm . 563 1. đặt vấn đề Cúm gia cầm (avian influenza) l một bệnh truyền nhiễm nguy hiểm có tốc độ lây lan nhanh, với tỷ lệ chết cao trong đn gia cầm nhiễm bệnh gây thiệt hại kinh tế lớn cho nhiều nớc trên thế giới. Từ năm 2003, cúm gia cầm do phân týp A/H5N1 xuất hiện tại Việt Nam v từ đó đến nay bệnh xảy ra liên tục v trở thnh một vấn đề dịch tễ phức tạp cần giải quyết tại nớc ta. Phân týp virus cúm A/H5N1 thuộc nhóm virus cúm A (Influenza virus A), họ Orthomyxoviridae, loại hình phân týp kháng nguyên bề mặt HA l H5 v NA l N1, có độc lực cao gây nhiễm v gây bệnh nặng nề ở gia cầm v cả trên ngời (Murphy v Webster, 1996). Gen H5 (phân đoạn 4 trong hệ gen ARN sợi đơn âm của virus) l một gen kháng nguyên, có vai trò quan trọng quyết định khả năng xâm nhiễm v độc lực gây bệnh của virus trên vật chủ (Baigent, McCauley, 2001). Hệ gen của virus cúm A biến đổi nhanh ở tất cả các phân đoạn gen, nhng thờng xảy ra nhất l ở gen HA v NA (Skeik v Jabr, 2008). Đặc điểm biến đổi thnh phần nucleotide v amino acid của gen H5 cho phép phân tích mối quan hệ tiến hoá, phân týp v phân định nhóm kháng nguyên (clade) của virus cúm A/H5N1 (Lê Thanh Ho v cs, 2008; Nguyen v cs, 2008). Virus cúm A/H5N1 phân lập từ cùng một địa điểm nhng trong thời gian khác nhau hoặc từ các nớc khác nhau trong cùng thời điểm, đều có thể có cấu trúc phân tử v đặc tính kháng nguyên khác nhau trong trình tự gen của chúng (Guan v cs, 2004; Li v cs, 2004). Vì vậy, việc nghiên cứu biến đổi th nh phần nội gen của kháng nguyên H5các chủng virus cờng độc phân lập qua các nămcác địa điểm khác nhau l yêu cầu cần thiết. Trong bi báo ny, chúng tôi trình by kết quả so sánh trình tự v phân tích sự biến đổi thnh phần gen H5, tìm hiểu mối quan hệ phả hệ của một chủng virus cúm A/H5N1 phân lập từ g Hậu Giang năm 2005 với các chủng phân lập từ ngời v gia cầm trong các năm 2005 - 2008 từ các vùng miền khác nhau của Việt Nam v một số nớc Đông Nam á. 2. NGUYÊN LIệU V PHƯƠNG PHáP NGHIÊN CứU 2.1. Bệnh phẩm Bệnh phẩm l dịch khí quản-phế quản chứa virus cờng độc cúm A/H5N1 thu thập từ g tại Hậu Giang, cuối năm 2005 (ký hiệu chủng: A/Ck/Vietnam/HG4/2005) đã đợc vô hoạt bằng nhiệt độ, bảo quản ở -20 o C. 2.2. Tách RNA hệ gen của virus,thiết kế mồi v thực hiện phản ứng RT-PCR RNA hệ gen của virus đợc tách chiết bằng bộ kit QIAamp Viral Mini kit (QIAGEN Inc.) từ mẫu bệnh phẩm, theo hớng dẫn của nh sản xuất. Cặp mồi dùng cho phản ứng RT-PCR để thu nhận ton bộ gen H5, bao gồm: Mồi xuôi H5BAMF: 5'CGGGATCC TCTGTCAAAATGGAG AAAATAGTGCTT3', tơng ứng vị trí 19 - 34 trong phân đoạn 4, có bố trí điểm cắt của enzym giới hạn BamHI (gạch bên dới) để thao tác tách dòng. Mồi ngợc H5NOTR: 5'ATAAGAATGCGGCCGC TCATTAA ATGCAAATTCTGCATTGTAACGA3', tơng ứng vị trí 1708 - 1735 trong phân đoạn 4, có bố trí điểm cắt của enzym giới hạn NotI (gạch bên dới), để thao tác tách dòng. Ton bộ phân đoạn HA của chủng A/Ck/Vietnam/HG4/2005 có độ di khoảng 1,7 kp đợc thu nhận bằng phản ứng RT - PCR một bớc với cặp mồi H5BAMF - H5NOTR, theo chu trình nhiệt nh sau: 50 o C/60 phút, 95 o C/15 phút, 35 chu kỳ [94 o C/1 phút, 55 o C/30 giây, 72 o C/2 phút], 72 o C/10 phút, sau chu kỳ cuối cùng bảo quản sản phẩm ở 4 o C cho đến khi kiểm tra v tinh sạch sản phẩm. Trn Quang Vui, Nguyn Th Bớch Nga, Lờ Thanh Ho 564 2.3. Kiểm tra sản phẩm RT-PCR, tinh sạch v dòng hoá sản phẩm vo vector tách dòng Sản phẩm RT - PCR đợc kiểm tra trên agarose 1%, tinh sạch bằng bộ kit QIAquick Purification kit (QIAGEN Inc.) v dòng hoá vo vector pCR2.1TOPO (Invitrogen). 2.4. Giải trình trình tự v phân tích số liệu Trình tự nucleotide DNA của plasmid đợc giải trình trên máy tự động ABI-3100 Avant Genetic Analyzer (Applied Biosystems). Chuỗi nucleotide đợc xử lý bằng chơng trình SeqEd1.03, Assembly LIGN1.9 v hệ chơng trình MacVector8.2 (Accelrys Inc.) trên máy tính Macintosh. Thnh phần amino acid đợc thu nhận bằng cách sử dụng bộ mã của vi sinh vật bậc thấp (vi khuẩn) trong ngân hng gen. So sánh đối chiếu, xử lý số liệu các chuỗi bằng chơng trình GENEDOC 2.5 v xây dựng phả hệ nguồn gốc bằng chơng trình MEGA4.0 (Tamura v cs, 2007). 2.5. Chọn chuỗi so sánh mức độ tơng đồng trình tự nucleotide Các chủng của Việt Nam v thế giới đã công bố đợc thu thập từ ngân hng gen (GenBank) bằng cách sử dụng chơng trình BLAST (http://www.ncbi.nlm.nih.gov) qua đối chiếu, so sánh với chuỗi nucleotide gen H5 của chủng virus cúm A/H5N1 từ g Hậu Giang. Tất cả có 19 chủng đợc sử dụng để so sánh v phân tích (Bảng 1). Bảng 1. Danh sách các chủng virus cúm A/H5N1 sử dụng để so sánh v phân tích gen H5 TT Ký hiu chng so sỏnh Loi mc Sub- type Nm phõn lp Ngun gc S ng ký trong Ngõn hng gen *T l (%) ng nht nucleotide 1 A-Ck-VN-HG4-05 G H5N1 2005 Hu Giang, Vit Nam EF051513 - 2 A-Ck-VN-LA-636-05 G H5N1 2005 Long An, Vit Nam ISDN230180 98 3 A-Dk-VN-CM498-06 Vt H5N1 2006 C Mau, Vit Nam EU124165 97 4 A-Ck-VN-NCVD09-05 G H5N1 2005 Vit Nam EF566200 97 5 A-HN-3040-05 Ngi H5N1 2005 Vit Nam AB239125 97 6 A-Ck-TL-Nontaburi-05 G H5N1 2005 Thỏi Lan DQ334776 98 7 A-mDk-VN-BT342-06 Ngan H5N1 2006 Bn Tre, Vit Nam ISDN230179 97 8 A-Dk-VN-18-07 Vt H5N1 2007 Kiờn Giang, Vit Nam CY029623 97 9 A-Ck-VN-29-07 G H5N1 2006 Hu Giang, Vit Nam CY029631 97 10 A-Ck-Indo-Soppeng-07 G H5N1 2007 Indonesia ISDN242846 95 11 A-Ck-Thailand-08 G H5N1 2008 Thỏi Lan EU497919 98 12 A-Ck-Fujian-584-06 G H5N1 2006 Phỳc Kin, Trung Quc DQ992831 94 13 A-Dk-VN-NA72-07 Vt H5N1 2007 Ngh An, Vit Nam ang ng ký 94 14 A-Dk-VN-53-07 Ngan H5N1 2007 Ngh An, Vit Nam CY029735 93 15 A-Ck-Laos- 36-06 G H5N1 2006 Lo ISDN239006 96 16 A-Ck-Laos-1-08 G H5N1 2008 Lo AB435522 95 17 A-mDk-VN-1455-06 Ngan H5N1 2006 H Tõy, Vit Nam CY029535 93 18 A-Dk-VN-50-07 Vt H5N1 2007 H Ni, Vit Nam CY029711 95 19 A-Dk-VN-43-07 Vt H5N1 2007 H Tõy, Vit Nam CY029687 94 20 A-VN-HN31242-07 Ngi H5N1 2007 H Ni, Vit Nam EU294370 95 *T l ng nht (%) v nucleotide (identity) gia chng A-Ck-VN-HG4-05 vi cỏc chng khỏc. 3. KếT QUả V THảO LUậN 3.1. Phân tích biến đổi thnh phần gen H5 của chủng A/Ck/Vietnam/HG4/2005 v so sánh với các chủng của Việt Nam v vùng Đông Nam á phân lập trong các năm 2005 - 2008 Bằng các phơng pháp sinh học phân tử, bao gồm RT-PCR, tách dòng, giải trình trình tự v phân tích chuỗi gen, chúng tôi thu nhận đợc ton bộ chuỗi gen H5 của chủng A/Ck/Vietnam/HG4/2005 có độ di 1707 nucleotide v đăng ký Ngân hng gen số: EF051513. Chúng tôi truy cập Nghiờn cu bin i thnh phn gen H5 ca virus cỳm . 565 ngân hng gen v thu thập chuỗi gen H5 của các chủng cờng độc đơng nhiễm (2005-2008) thuộc các vùng miền khác nhau của Việt Nam v Đông Nam á. Chủng A/Ck/Vietnam/HG4/2005 có mức độ tơng đồng cao với các chủng A/H5N1 đã công bố trong ngân hng gen, chứng tỏ gen HA thu nhận đợc chính xác l gen H5 của virus cúm A phân týp H5N1, thuộc dới dòng Quảng Đông (Guangdong sublineage). Nh vậy có thể khẳng định kết quả của quá trình tách dòng đã lu giữ đợc gen H5 của chủng A/Ck/Vietnam/HG4/2005 v có cơ sở để phân tích biến đổi thnh phần gen. Hai mơi chủng liệt kê ở bảng 1 đợc sắp xếp so sánh đối chiếu sử dụng chơng trình GENEDOC2.5. Các chủng số 2 đến 11 thuộc dới dòng Quảng Đông; các chủng số 12 đến 20 thuộc dới dòng Phúc Kiến (Bảng 1). Chủng A/Ck/Vietnam/HG4/2005 có tỷ lệ đồng nhất nucleotide (identity) thấp nhất l 95% (Bảng 1) v tỷ lệ tơng đồng amino acid (homology) thấp nhất l 97% với các chủng có nguồn gốc Quảng Đông (từ số 2 đến 11). Trong khi đó, với các chủng có nguồn gốc Phúc Kiến (từ số 12 đến 20), tỷ lệ đồng nhất nucleotide thấp nhất của chủng ny l 93% (Bảng 1) v tỷ lệ tơng đồng amino acid thấp nhất l 92% (số liệu không trình by ở đây). Kết quả so sánh đối chiếu trình tự nucleotide v amino acid của ton bộ chuỗi gen H5 (1707 bp mã hoá cho 568 amino acid) của chủng A/Ck/Vietnam/HG4/2005(H5N1) với các chủng A/H5N1 khác của Việt Nam v vùng Đông Nam á đợc trình by ở hình 1. * 20 * 40 * 60 * 80 * 100 * 120 A-Ck-VN-HG : ATGGAGAAAATAGTGCTTCTTTTTGCGATATTCAGTCTTGTTAAAAGTGATCAGATTTGCATTGGTTACCATGCAAACAACTCAACAGAGCAGGTTGACACAATAATGGAAAAGAACGTT : 120 A-Ck-VN-LA : G G : 120 A-Dk-VN-CM : G G : 120 A-Ck-VN-NC : A .G G : 120 A-HN-3040- : A .G G : 120 A-Ck-TL-No : A .G . : 120 A-mDk-VN-B : G . : 120 A-Dk-VN-18 : A .G G : 120 A-Ck-VN-29 : G G : 120 A-Ck-Indo- : .C A .GC .G T . : 120 A-Ck-TL-08 : A .G G : 120 A-Ck-Fujia : .C.G A .G C .G : 120 A-Dk-VN-NA : .C A .A C A G : 120 A-Dk-VN-53 : .C A .A C .G : 120 A-Ck-Laos- : .C G C : 120 A-Ck-Laos- : .C A .G C C G : 120 A-mDk-VN-1 : .A A .G C .G.C .G : 120 A-Dk-VN-50 : .C A .A C .G : 120 A-Dk-VN-43 : .C A .A C .G : 120 A-VN-HN312 : .C A .A C .G : 120 -----------------------------------------------------------------------------------------------------------------------------rut gon-------------------------------------------------------------------------------------------------------------------- * 980 * 1000 * 1020 * 1040 * 1060 * 1080 A-Ck-VN-HG : TATGTGAAATCAACCAGATTAGTCCTTGCGACTGGGCTCAGAAATAGCCCTCAAAGAGAGAGAAGAAGAAAAAAGAGAGGATTATTTGGAGCTATAGCAGGTTTTATAGAAGGAGGATGG : 1080 A-Ck-VN-LA : .A .T G . : 1080 A-Dk-VN-CM : .A G .G . : 1080 A-Ck-VN-NC : .A .--- G G : 1077 A-HN-3040- : .A .--- G . : 1077 A-Ck-TL-No : .A .A .A G . : 1080 A-mDk-VN-B : .A C .G .G . : 1080 A-Dk-VN-18 : .A G G G . : 1080 A-Ck-VN-29 : .A G .G .G . : 1080 A-Ck-Indo- : .A .C G . : 1080 A-Ck-TL-08 : .AT .G . : 1080 A-Ck-Fujia : .A A T T A .--- .C G . : 1077 A-Dk-VN-NA : .A A T T A .--- .C .C G C : 1077 A-Dk-VN-53 : .A A T T A .--- .C C .G C : 1077 A-Ck-Laos- : .A A T T A .--- .C G . : 1077 A-Ck-Laos- : .A A T .T T A .--- .C .G G . : 1077 A-mDk-VN-1 : .A A --- .C : 1077 A-Dk-VN-50 : .A A T T A .--- .C G C : 1077 A-Dk-VN-43 : .A A T T A .--- .C G C : 1077 A-VN-HN312 : .A A T T A .--- .C G C : 1077 ----------------------------------------------------------------------------------------------------------------------------rut gon---------------------------------------------------------------------------------------------------------------------- * 1580 * 1600 * 1620 * 1640 * 1660 * 1680 A-Ck-VN-HG : GGAGTAAAATTGGAATCAATAGGAATTTACCAAATACTGTCAATTTATTCTACAGTGGCGAGTTCCCTAGCACTGGCAATCATGGTAGCTGGTCTATCCTTATGGATGTGCTCCAATGGG : 1680 A-Ck-VN-LA : : 1680 A-Dk-VN-CM : .G .G : 1680 A-Ck-VN-NC : C .A . : 1677 A-HN-3040- : C .A . : 1677 A-Ck-TL-No : A .T . : 1680 A-mDk-VN-B : .G : 1680 A-Dk-VN-18 : .G .G : 1680 A-Ck-VN-29 : .G .C : 1680 A-Ck-Indo- : G .A .A.G . : 1680 A-Ck-TL-08 : .A : 1680 A-Ck-Fujia : .C A .T T G .T . : 1677 A-Dk-VN-NA : .C A .T T G .T . : 1677 A-Dk-VN-53 : .C A .T T G .T . : 1677 A-Ck-Laos- : G C A CT T G .T . : 1677 A-Ck-Laos- : .C A .T T G .T G : 1677 A-mDk-VN-1 : .C A .G .T G .------------- : 1664 A-Dk-VN-50 : .C A .T T G .T . : 1677 A-Dk-VN-43 : .C A .T T G .T . : 1677 A-VN-HN312 : .C A .T T G .T . : 1677 * 1700 A-Ck-VN-HG : TCGTTACAATGCAGAATTTGCATTTAA : 1707 A-Ck-VN-LA : . : 1707 A-Dk-VN-CM : . : 1707 A-Ck-VN-NC : --- : 1701 A-HN-3040- : .A G : 1704 A-Ck-TL-No : . : 1707 A-mDk-VN-B : . : 1707 A-Dk-VN-18 : . : 1707 A-Ck-VN-29 : . : 1707 A-Ck-Indo- : - : 1706 A-Ck-TL-08 : A : 1707 A-Ck-Fujia : --------- : 1695 A-Dk-VN-NA : . : 1704 A-Dk-VN-53 : ----------------------- : 1681 A-Ck-Laos- : --- : 1701 A-Ck-Laos- : . : 1704 A-mDk-VN-1 : --------------------------- : - A-Dk-VN-50 : . : 1704 A-Dk-VN-43 : --------- : 1695 A-VN-HN312 : . : 1704 A. H5 NUCLEOTIDE * 20 * 40 * 60 * 80 * 100 * 120 A-Ck-VN-HG : ATGGAGAAAATAGTGCTTCTTTTTGCGATATTCAGTCTTGTTAAAAGTGATCAGATTTGCATTGGTTACCATGCAAACAACTCAACAGAGCAGGTTGACACAATAATGGAAAAGAACGTT : 120 A-Ck-VN-LA : G G : 120 A-Dk-VN-CM : G G : 120 A-Ck-VN-NC : A .G G : 120 A-HN-3040- : A .G G : 120 A-Ck-TL-No : A .G . : 120 A-mDk-VN-B : G . : 120 A-Dk-VN-18 : A .G G : 120 A-Ck-VN-29 : G G : 120 A-Ck-Indo- : .C A .GC .G T . : 120 A-Ck-TL-08 : A .G G : 120 A-Ck-Fujia : .C.G A .G C .G : 120 A-Dk-VN-NA : .C A .A C A G : 120 A-Dk-VN-53 : .C A .A C .G : 120 A-Ck-Laos- : .C G C : 120 A-Ck-Laos- : .C A .G C C G : 120 A-mDk-VN-1 : .A A .G C .G.C .G : 120 A-Dk-VN-50 : .C A .A C .G : 120 A-Dk-VN-43 : .C A .A C .G : 120 A-VN-HN312 : .C A .A C .G : 120 -----------------------------------------------------------------------------------------------------------------------------rut gon-------------------------------------------------------------------------------------------------------------------- * 980 * 1000 * 1020 * 1040 * 1060 * 1080 A-Ck-VN-HG : TATGTGAAATCAACCAGATTAGTCCTTGCGACTGGGCTCAGAAATAGCCCTCAAAGAGAGAGAAGAAGAAAAAAGAGAGGATTATTTGGAGCTATAGCAGGTTTTATAGAAGGAGGATGG : 1080 A-Ck-VN-LA : .A .T G . : 1080 A-Dk-VN-CM : .A G .G . : 1080 A-Ck-VN-NC : .A .--- G G : 1077 A-HN-3040- : .A .--- G . : 1077 A-Ck-TL-No : .A .A .A G . : 1080 A-mDk-VN-B : .A C .G .G . : 1080 A-Dk-VN-18 : .A G G G . : 1080 A-Ck-VN-29 : .A G .G .G . : 1080 A-Ck-Indo- : .A .C G . : 1080 A-Ck-TL-08 : .AT .G . : 1080 A-Ck-Fujia : .A A T T A .--- .C G . : 1077 A-Dk-VN-NA : .A A T T A .--- .C .C G C : 1077 A-Dk-VN-53 : .A A T T A .--- .C C .G C : 1077 A-Ck-Laos- : .A A T T A .--- .C G . : 1077 A-Ck-Laos- : .A A T .T T A .--- .C .G G . : 1077 A-mDk-VN-1 : .A A --- .C : 1077 A-Dk-VN-50 : .A A T T A .--- .C G C : 1077 A-Dk-VN-43 : .A A T T A .--- .C G C : 1077 A-VN-HN312 : .A A T T A .--- .C G C : 1077 ----------------------------------------------------------------------------------------------------------------------------rut gon---------------------------------------------------------------------------------------------------------------------- * 1580 * 1600 * 1620 * 1640 * 1660 * 1680 A-Ck-VN-HG : GGAGTAAAATTGGAATCAATAGGAATTTACCAAATACTGTCAATTTATTCTACAGTGGCGAGTTCCCTAGCACTGGCAATCATGGTAGCTGGTCTATCCTTATGGATGTGCTCCAATGGG : 1680 A-Ck-VN-LA : : 1680 A-Dk-VN-CM : .G .G : 1680 A-Ck-VN-NC : C .A . : 1677 A-HN-3040- : C .A . : 1677 A-Ck-TL-No : A .T . : 1680 A-mDk-VN-B : .G : 1680 A-Dk-VN-18 : .G .G : 1680 A-Ck-VN-29 : .G .C : 1680 A-Ck-Indo- : G .A .A.G . : 1680 A-Ck-TL-08 : .A : 1680 A-Ck-Fujia : .C A .T T G .T . : 1677 A-Dk-VN-NA : .C A .T T G .T . : 1677 A-Dk-VN-53 : .C A .T T G .T . : 1677 A-Ck-Laos- : G C A CT T G .T . : 1677 A-Ck-Laos- : .C A .T T G .T G : 1677 A-mDk-VN-1 : .C A .G .T G .------------- : 1664 A-Dk-VN-50 : .C A .T T G .T . : 1677 A-Dk-VN-43 : .C A .T T G .T . : 1677 A-VN-HN312 : .C A .T T G .T . : 1677 * 1700 A-Ck-VN-HG : TCGTTACAATGCAGAATTTGCATTTAA : 1707 A-Ck-VN-LA : . : 1707 A-Dk-VN-CM : . : 1707 A-Ck-VN-NC : --- : 1701 A-HN-3040- : .A G : 1704 A-Ck-TL-No : . : 1707 A-mDk-VN-B : . : 1707 A-Dk-VN-18 : . : 1707 A-Ck-VN-29 : . : 1707 A-Ck-Indo- : - : 1706 A-Ck-TL-08 : A : 1707 A-Ck-Fujia : --------- : 1695 A-Dk-VN-NA : . : 1704 A-Dk-VN-53 : ----------------------- : 1681 A-Ck-Laos- : --- : 1701 A-Ck-Laos- : . : 1704 A-mDk-VN-1 : --------------------------- : - A-Dk-VN-50 : . : 1704 A-Dk-VN-43 : --------- : 1695 A-VN-HN312 : . : 1704 A. H5 NUCLEOTIDE * 20 * 40 * 60 * 80 * 100 * 120 A-Ck-VN-HG : ATGGAGAAAATAGTGCTTCTTTTTGCGATATTCAGTCTTGTTAAAAGTGATCAGATTTGCATTGGTTACCATGCAAACAACTCAACAGAGCAGGTTGACACAATAATGGAAAAGAACGTT : 120 A-Ck-VN-LA : G G : 120 A-Dk-VN-CM : G G : 120 A-Ck-VN-NC : A .G G : 120 A-HN-3040- : A .G G : 120 A-Ck-TL-No : A .G . : 120 A-mDk-VN-B : G . : 120 A-Dk-VN-18 : A .G G : 120 A-Ck-VN-29 : G G : 120 A-Ck-Indo- : .C A .GC .G T . : 120 A-Ck-TL-08 : A .G G : 120 A-Ck-Fujia : .C.G A .G C .G : 120 A-Dk-VN-NA : .C A .A C A G : 120 A-Dk-VN-53 : .C A .A C .G : 120 A-Ck-Laos- : .C G C : 120 A-Ck-Laos- : .C A .G C C G : 120 A-mDk-VN-1 : .A A .G C .G.C .G : 120 A-Dk-VN-50 : .C A .A C .G : 120 A-Dk-VN-43 : .C A .A C .G : 120 A-VN-HN312 : .C A .A C .G : 120 -----------------------------------------------------------------------------------------------------------------------------rut gon-------------------------------------------------------------------------------------------------------------------- * 980 * 1000 * 1020 * 1040 * 1060 * 1080 A-Ck-VN-HG : TATGTGAAATCAACCAGATTAGTCCTTGCGACTGGGCTCAGAAATAGCCCTCAAAGAGAGAGAAGAAGAAAAAAGAGAGGATTATTTGGAGCTATAGCAGGTTTTATAGAAGGAGGATGG : 1080 A-Ck-VN-LA : .A .T G . : 1080 A-Dk-VN-CM : .A G .G . : 1080 A-Ck-VN-NC : .A .--- G G : 1077 A-HN-3040- : .A .--- G . : 1077 A-Ck-TL-No : .A .A .A G . : 1080 A-mDk-VN-B : .A C .G .G . : 1080 A-Dk-VN-18 : .A G G G . : 1080 A-Ck-VN-29 : .A G .G .G . : 1080 A-Ck-Indo- : .A .C G . : 1080 A-Ck-TL-08 : .AT .G . : 1080 A-Ck-Fujia : .A A T T A .--- .C G . : 1077 A-Dk-VN-NA : .A A T T A .--- .C .C G C : 1077 A-Dk-VN-53 : .A A T T A .--- .C C .G C : 1077 A-Ck-Laos- : .A A T T A .--- .C G . : 1077 A-Ck-Laos- : .A A T .T T A .--- .C .G G . : 1077 A-mDk-VN-1 : .A A --- .C : 1077 A-Dk-VN-50 : .A A T T A .--- .C G C : 1077 A-Dk-VN-43 : .A A T T A .--- .C G C : 1077 A-VN-HN312 : .A A T T A .--- .C G C : 1077 ----------------------------------------------------------------------------------------------------------------------------rut gon---------------------------------------------------------------------------------------------------------------------- * 1580 * 1600 * 1620 * 1640 * 1660 * 1680 A-Ck-VN-HG : GGAGTAAAATTGGAATCAATAGGAATTTACCAAATACTGTCAATTTATTCTACAGTGGCGAGTTCCCTAGCACTGGCAATCATGGTAGCTGGTCTATCCTTATGGATGTGCTCCAATGGG : 1680 A-Ck-VN-LA : : 1680 A-Dk-VN-CM : .G .G : 1680 A-Ck-VN-NC : C .A . : 1677 A-HN-3040- : C .A . : 1677 A-Ck-TL-No : A .T . : 1680 A-mDk-VN-B : .G : 1680 A-Dk-VN-18 : .G .G : 1680 A-Ck-VN-29 : .G .C : 1680 A-Ck-Indo- : G .A .A.G . : 1680 A-Ck-TL-08 : .A : 1680 A-Ck-Fujia : .C A .T T G .T . : 1677 A-Dk-VN-NA : .C A .T T G .T . : 1677 A-Dk-VN-53 : .C A .T T G .T . : 1677 A-Ck-Laos- : G C A CT T G .T . : 1677 A-Ck-Laos- : .C A .T T G .T G : 1677 A-mDk-VN-1 : .C A .G .T G .------------- : 1664 A-Dk-VN-50 : .C A .T T G .T . : 1677 A-Dk-VN-43 : .C A .T T G .T . : 1677 A-VN-HN312 : .C A .T T G .T . : 1677 * 1700 A-Ck-VN-HG : TCGTTACAATGCAGAATTTGCATTTAA : 1707 A-Ck-VN-LA : . : 1707 A-Dk-VN-CM : . : 1707 A-Ck-VN-NC : --- : 1701 A-HN-3040- : .A G : 1704 A-Ck-TL-No : . : 1707 A-mDk-VN-B : . : 1707 A-Dk-VN-18 : . : 1707 A-Ck-VN-29 : . : 1707 A-Ck-Indo- : - : 1706 A-Ck-TL-08 : A : 1707 A-Ck-Fujia : --------- : 1695 A-Dk-VN-NA : . : 1704 A-Dk-VN-53 : ----------------------- : 1681 A-Ck-Laos- : --- : 1701 A-Ck-Laos- : . : 1704 A-mDk-VN-1 : --------------------------- : - A-Dk-VN-50 : . : 1704 A-Dk-VN-43 : --------- : 1695 A-VN-HN312 : . : 1704 A. H5 NUCLEOTIDE Trn Quang Vui, Nguyn Th Bớch Nga, Lờ Thanh Ho 566 Hình 1. So sánh trình tự nucleotide (rút gọn) (Hình 1A) v ton bộ trình tự amino acid (Hình 1B) của gen H5 giữa chủng A/Ck/Vietnam/HG4/2005 với các chủng A/H5N1 của Việt Nam, Trung Quốc v vùng Đông Nam á. Phần đóng khung biểu thị sai khác của chủng A/Ck/Vietnam/HG4/2005 với các chủng khác Có 9 vị trí m ở đó thnh phần nucleotide gen H5 của chủng A/ Ck/ Vietnam/ HG4/ 2005 có sai khác hon ton so với 19 chủng chủng phân lậpViệt Nam v vùng Đông Nam á trong các năm 2005 - 2008 v 2 vị trí sai khác với 18 chủng (chỉ tơng đồng với 1 chủng). Hầu hết các sai khác ny l đột biến thay thế Adenin Guanin (A<->G). Ngoi những sai khác trên v những sai khác có * 20 * 40 * 60 * 80 * 100 * 120 A-Ck-VN-HG : MEKIVLLFAIFSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKANPVNDLCYPGDFNDYEELKHL : 120 A-Ck-VN-LA : V . : 120 A-Dk-VN-CM : V .N V : 120 A-Ck-VN-NC : V . : 120 A-HN-3040- : V . : 120 A-Ck-TL-No : V A : 120 A-mDk-VN-B : V V : 120 A-Dk-VN-18 : T.V V : 120 A-Ck-VN-29 : V . : 120 A-Ck-Indo- : .L A G V A .N : 120 A-Ck-TL-08 : V . : 120 A-Ck-Fujia : .L V .K.L A .NL . : 120 A-Dk-VN-NA : .L I Y R A .N : 120 A-Dk-VN-53 : .L I .R A .N : 120 A-Ck-Laos- : .L V A .N : 120 A-Ck-Laos- : .L V A .N : 120 A-mDk-VN-1 : .I V G .A.G .N : 120 A-Dk-VN-50 : .L I A .N : 120 A-Dk-VN-43 : .L I .R A .N : 120 A-VN-HN312 : .L I A : 120 * 140 * 160 * 180 * 200 * 220 * 240 A-Ck-VN-HG : LSRINHFEKIQIIPKSSWSSHEASLGVSSACPYQGKSSFFRNVVWLIKKNSTYPTIKRSYNNTNQEDLLVMWGIHHPNDAAEQTKLYQNPTTYISVGTSTLNQRLVPRIATRSKVNGQSG : 240 A-Ck-VN-LA : A T : 240 A-Dk-VN-CM : P .A .I T : 240 A-Ck-VN-NC : P R L I : 240 A-HN-3040- : L .L . : 240 A-Ck-TL-No : I .L . : 240 A-mDk-VN-B : P .A I .T : 240 A-Dk-VN-18 : P .A T : 240 A-Ck-VN-29 : P .A T : 240 A-Ck-Indo- : .D S L.TP .L K : 240 A-Ck-TL-08 : R L.R L . : 240 A-Ck-Fujia : Y D S TP .N IL .S E .KR K : 240 A-Dk-VN-NA : .D S V .VP I N IL .S D .K : 240 A-Dk-VN-53 : .D S VP .N IL .S KL . : 240 A-Ck-Laos- : .D S TP .N .L .S K : 240 A-Ck-Laos- : .D S TP .N .N IL .S I .K : 240 A-mDk-VN-1 : .D .S NA L E R V.I .K : 240 A-Dk-VN-50 : .D S VP .N IL .S K : 240 A-Dk-VN-43 : .D S VP .N IL .S K : 240 A-VN-HN312 : .D S VP .N IL .S K : 240 * 260 * 280 * 300 * 320 * 340 * 360 A-Ck-VN-HG : RIEFFWTILKPNDAINFESNGNFIAPEYAYKIVKRGDSTIMKSELEYGNCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSTRLVLATGLRNSPQRERRRKKRGLFGAIAGFIEGGW : 360 A-Ck-VN-LA : .M K M N .I . : 360 A-Dk-VN-CM : .M K M N .G . : 360 A-Ck-VN-NC : .M K M N .- . : 359 A-HN-3040- : .M K M N .- . : 359 A-Ck-TL-No : .M K M N .K . : 360 A-mDk-VN-B : .M K M N .G . : 360 A-Dk-VN-18 : .M K M N .G . : 360 A-Ck-VN-29 : .M K M N .G . : 360 A-Ck-Indo- : .M K .A M N . : 360 A-Ck-TL-08 : .M .S K M N . : 360 A-Ck-Fujia : .MD .K .A .V .D .NK .L - . : 359 A-Dk-VN-NA : .MD .K .A .V V NK .L - .S . : 359 A-Dk-VN-53 : .MD .K .A .V .NK .L - . : 359 A-Ck-Laos- : .MD M K .NK .L - . : 359 A-Ck-Laos- : .MD .E .A .V .NK .L - . : 359 A-mDk-VN-1 : .MD .K .A .V M NK - . : 359 A-Dk-VN-50 : .MD .K .A .V .NK .L - . : 359 A-Dk-VN-43 : .MD .K .A .V .NK .L - . : 359 A-VN-HN312 : .MD .K .A .V .NK .L - . : 359 B. H5 AMINO ACID * 20 * 40 * 60 * 80 * 100 * 120 A-Ck-VN-HG : MEKIVLLFAIFSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKANPVNDLCYPGDFNDYEELKHL : 120 A-Ck-VN-LA : V . : 120 A-Dk-VN-CM : V .N V : 120 A-Ck-VN-NC : V . : 120 A-HN-3040- : V . : 120 A-Ck-TL-No : V A : 120 A-mDk-VN-B : V V : 120 A-Dk-VN-18 : T.V V : 120 A-Ck-VN-29 : V . : 120 A-Ck-Indo- : .L A G V A .N : 120 A-Ck-TL-08 : V . : 120 A-Ck-Fujia : .L V .K.L A .NL . : 120 A-Dk-VN-NA : .L I Y R A .N : 120 A-Dk-VN-53 : .L I .R A .N : 120 A-Ck-Laos- : .L V A .N : 120 A-Ck-Laos- : .L V A .N : 120 A-mDk-VN-1 : .I V G .A.G .N : 120 A-Dk-VN-50 : .L I A .N : 120 A-Dk-VN-43 : .L I .R A .N : 120 A-VN-HN312 : .L I A : 120 * 140 * 160 * 180 * 200 * 220 * 240 A-Ck-VN-HG : LSRINHFEKIQIIPKSSWSSHEASLGVSSACPYQGKSSFFRNVVWLIKKNSTYPTIKRSYNNTNQEDLLVMWGIHHPNDAAEQTKLYQNPTTYISVGTSTLNQRLVPRIATRSKVNGQSG : 240 A-Ck-VN-LA : A T : 240 A-Dk-VN-CM : P .A .I T : 240 A-Ck-VN-NC : P R L I : 240 A-HN-3040- : L .L . : 240 A-Ck-TL-No : I .L . : 240 A-mDk-VN-B : P .A I .T : 240 A-Dk-VN-18 : P .A T : 240 A-Ck-VN-29 : P .A T : 240 A-Ck-Indo- : .D S L.TP .L K : 240 A-Ck-TL-08 : R L.R L . : 240 A-Ck-Fujia : Y D S TP .N IL .S E .KR K : 240 A-Dk-VN-NA : .D S V .VP I N IL .S D .K : 240 A-Dk-VN-53 : .D S VP .N IL .S KL . : 240 A-Ck-Laos- : .D S TP .N .L .S K : 240 A-Ck-Laos- : .D S TP .N .N IL .S I .K : 240 A-mDk-VN-1 : .D .S NA L E R V.I .K : 240 A-Dk-VN-50 : .D S VP .N IL .S K : 240 A-Dk-VN-43 : .D S VP .N IL .S K : 240 A-VN-HN312 : .D S VP .N IL .S K : 240 * 260 * 280 * 300 * 320 * 340 * 360 A-Ck-VN-HG : RIEFFWTILKPNDAINFESNGNFIAPEYAYKIVKRGDSTIMKSELEYGNCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSTRLVLATGLRNSPQRERRRKKRGLFGAIAGFIEGGW : 360 A-Ck-VN-LA : .M K M N .I . : 360 A-Dk-VN-CM : .M K M N .G . : 360 A-Ck-VN-NC : .M K M N .- . : 359 A-HN-3040- : .M K M N .- . : 359 A-Ck-TL-No : .M K M N .K . : 360 A-mDk-VN-B : .M K M N .G . : 360 A-Dk-VN-18 : .M K M N .G . : 360 A-Ck-VN-29 : .M K M N .G . : 360 A-Ck-Indo- : .M K .A M N . : 360 A-Ck-TL-08 : .M .S K M N . : 360 A-Ck-Fujia : .MD .K .A .V .D .NK .L - . : 359 A-Dk-VN-NA : .MD .K .A .V V NK .L - .S . : 359 A-Dk-VN-53 : .MD .K .A .V .NK .L - . : 359 A-Ck-Laos- : .MD M K .NK .L - . : 359 A-Ck-Laos- : .MD .E .A .V .NK .L - . : 359 A-mDk-VN-1 : .MD .K .A .V M NK - . : 359 A-Dk-VN-50 : .MD .K .A .V .NK .L - . : 359 A-Dk-VN-43 : .MD .K .A .V .NK .L - . : 359 A-VN-HN312 : .MD .K .A .V .NK .L - . : 359 * 20 * 40 * 60 * 80 * 100 * 120 A-Ck-VN-HG : MEKIVLLFAIFSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKANPVNDLCYPGDFNDYEELKHL : 120 A-Ck-VN-LA : V . : 120 A-Dk-VN-CM : V .N V : 120 A-Ck-VN-NC : V . : 120 A-HN-3040- : V . : 120 A-Ck-TL-No : V A : 120 A-mDk-VN-B : V V : 120 A-Dk-VN-18 : T.V V : 120 A-Ck-VN-29 : V . : 120 A-Ck-Indo- : .L A G V A .N : 120 A-Ck-TL-08 : V . : 120 A-Ck-Fujia : .L V .K.L A .NL . : 120 A-Dk-VN-NA : .L I Y R A .N : 120 A-Dk-VN-53 : .L I .R A .N : 120 A-Ck-Laos- : .L V A .N : 120 A-Ck-Laos- : .L V A .N : 120 A-mDk-VN-1 : .I V G .A.G .N : 120 A-Dk-VN-50 : .L I A .N : 120 A-Dk-VN-43 : .L I .R A .N : 120 A-VN-HN312 : .L I A : 120 * 140 * 160 * 180 * 200 * 220 * 240 A-Ck-VN-HG : LSRINHFEKIQIIPKSSWSSHEASLGVSSACPYQGKSSFFRNVVWLIKKNSTYPTIKRSYNNTNQEDLLVMWGIHHPNDAAEQTKLYQNPTTYISVGTSTLNQRLVPRIATRSKVNGQSG : 240 A-Ck-VN-LA : A T : 240 A-Dk-VN-CM : P .A .I T : 240 A-Ck-VN-NC : P R L I : 240 A-HN-3040- : L .L . : 240 A-Ck-TL-No : I .L . : 240 A-mDk-VN-B : P .A I .T : 240 A-Dk-VN-18 : P .A T : 240 A-Ck-VN-29 : P .A T : 240 A-Ck-Indo- : .D S L.TP .L K : 240 A-Ck-TL-08 : R L.R L . : 240 A-Ck-Fujia : Y D S TP .N IL .S E .KR K : 240 A-Dk-VN-NA : .D S V .VP I N IL .S D .K : 240 A-Dk-VN-53 : .D S VP .N IL .S KL . : 240 A-Ck-Laos- : .D S TP .N .L .S K : 240 A-Ck-Laos- : .D S TP .N .N IL .S I .K : 240 A-mDk-VN-1 : .D .S NA L E R V.I .K : 240 A-Dk-VN-50 : .D S VP .N IL .S K : 240 A-Dk-VN-43 : .D S VP .N IL .S K : 240 A-VN-HN312 : .D S VP .N IL .S K : 240 * 260 * 280 * 300 * 320 * 340 * 360 A-Ck-VN-HG : RIEFFWTILKPNDAINFESNGNFIAPEYAYKIVKRGDSTIMKSELEYGNCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSTRLVLATGLRNSPQRERRRKKRGLFGAIAGFIEGGW : 360 A-Ck-VN-LA : .M K M N .I . : 360 A-Dk-VN-CM : .M K M N .G . : 360 A-Ck-VN-NC : .M K M N .- . : 359 A-HN-3040- : .M K M N .- . : 359 A-Ck-TL-No : .M K M N .K . : 360 A-mDk-VN-B : .M K M N .G . : 360 A-Dk-VN-18 : .M K M N .G . : 360 A-Ck-VN-29 : .M K M N .G . : 360 A-Ck-Indo- : .M K .A M N . : 360 A-Ck-TL-08 : .M .S K M N . : 360 A-Ck-Fujia : .MD .K .A .V .D .NK .L - . : 359 A-Dk-VN-NA : .MD .K .A .V V NK .L - .S . : 359 A-Dk-VN-53 : .MD .K .A .V .NK .L - . : 359 A-Ck-Laos- : .MD M K .NK .L - . : 359 A-Ck-Laos- : .MD .E .A .V .NK .L - . : 359 A-mDk-VN-1 : .MD .K .A .V M NK - . : 359 A-Dk-VN-50 : .MD .K .A .V .NK .L - . : 359 A-Dk-VN-43 : .MD .K .A .V .NK .L - . : 359 A-VN-HN312 : .MD .K .A .V .NK .L - . : 359 B. H5 AMINO ACID Nghiờn cu bin i thnh phn gen H5 ca virus cỳm . 567 tính chất đơn lẻ khác, trình tự gen H5 của chủng A/ Ck/ Vietnam/ HG4/ 2005 còn có 1 vị trí sai khác với tất cả các chủng thuộc dới dòng Quảng Đông v 43 vị trí sai khác với các chủng dới dòng Phúc Kiến. Sự thay đổi ny đã lm sai khác 5 amino acid (ở các vị trí: 11, 242, 275, 325, 512) so với tất cả các chủng so sánh, 1 amino acid (298) so với các chủng dới dòng Quảng Đông v 17 amino acid (8, 102, 110, 140, 145, 156, 157, 171, 191, 197, 228, 243, 279, 285, 326, 338, v 529) so với các chủng dới dòng Phúc Kiến. Kết quả ny cho thấy virus A/H5N1 có khả năng biến đổi nội gen kháng nguyên tơng đối cao. Chuỗi gen H5 của chủng A/ Ck/ Vietnam/ HG4/ 2005 v các chủng dới dòng Quảng Đông phân lập tại Việt Nam cũng nh ở một số nớc Đông Nam á đều có kích thớc chính xác l 1707 nucleotide, trong khi đó các chủng thuộc dới dòng Phúc Kiến thiếu hụt 3 nucleotide (Hình 1A) (Lê Thanh Hòa v cs, 2008). Do đó, vùng amino acid tạo nên điểm cắt của protease ở chủng A/ Ck/ Vietnam/ HG4/ 2005 v các chủng dới dòng Quảng Đông có đầy đủ thnh phần - RRRKK-, một đặc tính quan trọng quyết định độc lực của virus cúm A/H5N1, trong khi đó các chủng dới dòng Phúc Kiến thiếu hụt 1 amino acid Lysine (K) (Hình 1B). Điều ny có thể l nguyên nhân chính lm gia tăng độc lực gây bệnh của virus A/H5N1 thuộc dới dòng Phúc Kiến hay không còn l vấn đề cần xác định. 3.2. Phân tích mối quan hệ phả hệ của chủng A/Ck/Vietnam/HG4/2005(H5N1) Quan hệ phả hệ của chủng cúm A/H5N1 phân lập từ g Hậu Giang (chủng A/ Ck/ Vietnam/ HG4/ 2005 (H5N1)) của chúng tôi nghiên cứu, đợc phân tích so sánh với các chủng khác của Việt Nam, Trung Quốc v Đông Nam á, kết quả trình by ở hình 2. Các chủng phân lập ở miền nam Việt Nam trong các năm 2005 - 2007: A-Ck-VN-LA-636-05 (ISDN230180), A-Dk- VN - CM498-06 (EU124165), A - mDk - VN - BT342 - 06 (ISDN230179), A - Dk - VN - 18 - 07 (CY029623), A - Ck - VN - 29 - 07 (CY02963) tập hợp trong cùng một nhóm với chủng A/ Ck/ Vietnam/ HG4/ 2005 (H5N1) (EF051513) phân lập từ g tại Hậu Giang (Hình 2). Điều ny cho phép nhận xét, có thể các chủng cúm A/H5N1 từ gia cầm Hậu Giang, Long An, Kiên Giang, C Mau, Bến Tre l có cùng nguồn gốc v thuộc nhóm di truyền 1 (clade 1) (Nguyen v cs, 2008). Đây l các chủng cúm A/H5N1 thuộc dới dòng Quảng Đông. Trong khi đó, cây phả hệ (Hình 2) cho thấy, các chủng phân lập từ ngời v gia cầm ở miền Bắc v miền Trung năm 2007, bao gồm: A - Dk - VN - 50 - 07 (H5N1) (CY029711), A - Dk - VN - 43 - 07 (H5N1) (CY029687), A - VN - HN31242 - 07 (H5N1) (EU294370), A - Dk - VN - NA72 - 07 (H5N1), A - Dk - VN - 53 - 07 (H5N1) (CY029735) v chủng A - Ck - Laos - 1 - 08 (H5N1) (AB435522) tập hợp trong cùng một nhóm, với chủng chính gốc Phúc Kiến phân lập năm 2006 v thuộc nhóm di truyền 2.3.4 (clade 2.3.4) (Nguyen v cs, 2008). Đây l các chủng thuộc dới dòng Phúc Kiến. Nh vậy, trong các năm giai đoạn 2005-2008, ngoi các chủng thuộc dới dòng Quảng Đông (trong đó có chủng A/ Ck/ Vietnam/ HG4/ 2005 (H5N1)), ở nhiều nớc châu á (Trung Quốc, Việt Nam, Lo) còn xuất hiện các chủng thuộc dới dòng Phúc Kiến gây bệnh cúm gia cầm. Trn Quang Vui, Nguyn Th Bớch Nga, Lờ Thanh Ho 568 Hình 2. Phân tích phả hệ của các chủng cúm A/H5N1 của Việt Nam v vùng Đông Nam á dựa trên thnh phần nucleotide của gen H5 sử dụng bootstraps 1000 replicate, Neighbor-Joining, Kimura 2-parameter (Tamura v cs, 2007). Có hai nhóm chính (Quảng Đông v Phúc Kiến), trong đó chủng A/Ck/Vietnam/HG4/2005(H5N1)) thuộc dới dòng Quảng Đông 4. KếT LUậN Ton bộ chuỗi gen HA của chủng cúm A/H5N1 phân lập từ g Hậu Giang (A/ Ck/ Vietnam/ HG4/ 2005 (H5N1)) có độ di 1707 bp đã đợc giải trình trình tự, đợc xác định l gen H5 của virus cúm A/H5N1, có 9 vị trí sai khác hon ton so với 19 chủng phân lập trong các năm 2005 - 2008 từ ngời v gia cầm của Việt Nam, Trung Quốc v vùng Đông Nam á; trong cấu trúc có đầy đủ các amino acid (-RRKK-) tại vị trí cắt của protease. Chủng A/ Ck/ Vietnam/ HG4/ 2005 (H5N1) có cùng nguồn gốc thuộc dới dòng Quảng Đông cùng với một số chủng cúm A/H5N1 từ gia cầm ở Hậu Giang, Long An, Kiên Giang, C Mau, Bến Tre (Việt Nam) v một số chủng trong vùng Đông Nam á phân lập trong các năm 2005 - 2008. Lời cảm ơn Cảm ơn Bộ Khoa học v Công nghệ về Nhiệm vụ Nghị định th Việt Nam - Thái Lan v Phòng Thí nghiệm trọng điểm Công nghệ gen (Viện Công nghệ sinh học) hỗ trợ kinh phí v trang thiết bị để chúng tôi thực hiện đề ti ny. Ti liệu tham khảo Baigent SJ and McCauley JW (2001). Glycosylation of hemagglutinin and stalk-length of neuraminidase combine A-Dk-VN-CM498-06EU124165 A-Dk-VN-18-07CY029623 A-mDk-VN-BT342-06ISDN230179 A-Ck-VN-29-07CY029631 A-Ck-VN-LA-636-05ISDN230180 A-Ck-VN-HG4-05EF051513 A-Ck-TL-Nontaburi-05DQ334776 A-Ck-TL-08EU497919 A-Ck-VN-NCVD09-05EF566200 A-HN-3040-05AB239125 A-Ck-Indo-Soppeng-07ISDN242846 A-mDk-VN-1455-06CY029535 A-Ck-Laos-36-06ISDN239006 A-Ck-Fujian-584-06DQ992831 A-Ck-Laos-1-08AB435522 A-Dk-VN-50-07CY029711 A-VN-HN31242-07EU294370 A-Dk-VN-43-07CY029687 A-Dk-VN-NA72-07 A-Dk-VN-53-07CY029735 0.005 DidũngQung ụng Di dũng Phỳc Kin A-Dk-VN-CM498-06EU124165 A-Dk-VN-18-07CY029623 A-mDk-VN-BT342-06ISDN230179 A-Ck-VN-29-07CY029631 A-Ck-VN-LA-636-05ISDN230180 A-Ck-VN-HG4-05EF051513 A-Ck-TL-Nontaburi-05DQ334776 A-Ck-TL-08EU497919 A-Ck-VN-NCVD09-05EF566200 A-HN-3040-05AB239125 A-Ck-Indo-Soppeng-07ISDN242846 A-mDk-VN-1455-06CY029535 A-Ck-Laos-36-06ISDN239006 A-Ck-Fujian-584-06DQ992831 A-Ck-Laos-1-08AB435522 A-Dk-VN-50-07CY029711 A-VN-HN31242-07EU294370 A-Dk-VN-43-07CY029687 A-Dk-VN-NA72-07 A-Dk-VN-53-07CY029735 0.005 DidũngQung ụng Di dũng Phỳc Kin Nghiờn cu bin i thnh phn gen H5 ca virus cỳm . 569 to regulate the growth of avian influenza viruses in tissue culture. Virus Res. 79 (1-2): 177-185. Guan Y, Poon LL, Cheung CY, Ellis TM, Lim W, Lipatov AS, Chan KH, Sturm- Ramirez KM, Cheung CL, Leung YH, Yuen KY, Webster RG, Peiris JS (2004). H5N1 influenza: a protean pandemic threat. PNAS USA 101: 8156-8161. Lê Thanh Ho, Nguyễn Thị Bích Nga, Trần Quang Vui, Nguyễn Mạnh Kiên, Nguyễn Xuân Vũ, Lê Trần Bình (2008). Phát hiện biến chủng virus cúm A/H5N1 dòng Phúc Kiến gây bệnh trên gia cầm/ngời tại Việt Nam (pp 699- 702). Tập san Hội nghị khoa học ton quốc lần thứ t: Hóa sinh v Sinh học phân tử phục vụ nông, sinh, y học v công nghiệp thực phẩm (H Nội, 16 - 17/10/2008). NXB Khoa học v Kỹ thuật, H Nội (924 trang). Li KS, Guan Y, Wang J, Smith GJ, Xu KM, Duan L, Rahardjo AP, Puthavathana P, Buranathai C, Nguyen TD, Estoepangestie AT, Chaisingh A, Auewarakul P, Long HT, Hanh NT, Webby R, Poon LL, Chen H, Shortridge KF, Yuen KY, Webster RG, Peiris JS (2004). Genesis of a highly pathogenic and potentially pandemic H5N1 influenza virus in eastern Asia. Nature 430: 209-213. Murphy BR and Webster RG (1996). Orthomyxoviruses. In Fields BN, Knipe DM, Howley PM (eds.). Fields Virology 3 rd ed. Lippincott-Raven Publishers, Philadelphia: 1397-1445. Nguyen TD, Nguyen TV, Vijaykrishna D, Webster RG, Guan Y, Peiris MJS, Smith GJD (2008). Multiple Sublineages of Influenza A Virus (H5N1), Vietnam, 2005-2007. Emerging Infectious Diseases 14(4): 632-636. Skeik N, Jabr FI (2008). Influenza viruses and the evolution of avian influenza virus H5N1. Int J Infect Dis 12(3): 233- 8. Review. Tamura K, Dudley J, Nei M and Kumar S (2007). MEGA4: Molecular Evolutionary Genetics Analysis (MEGA) software version 4.0. Mol Biol Evol 24: 1596-1599. . Di dũng Phỳc Kin Nghiờn cu bin i thnh phn gen H5 ca virus cỳm . 569 to regulate the growth of avian influenza viruses in tissue culture. Virus Res. 79. an avian influenza isolate collected from chicken in Hau Giang province (designated as A/Ck/Vietnam/HG4/2005) was obtained, completely sequenced (GenBank:
- Xem thêm -

Xem thêm: NGHIÊN CứU BIếN ĐổI THàNH PHầN GEN H5 CủA VIRUS CúM A/H5N1 PHÂN LậP Từ Gà HậU GIANG SO SáNH VớI CáC CHủNG CủA VIệT NAM Và VùNG ĐÔNG NAM CHÂU á (2005 - 2008), NGHIÊN CứU BIếN ĐổI THàNH PHầN GEN H5 CủA VIRUS CúM A/H5N1 PHÂN LậP Từ Gà HậU GIANG SO SáNH VớI CáC CHủNG CủA VIệT NAM Và VùNG ĐÔNG NAM CHÂU á (2005 - 2008)

Từ khóa liên quan

Gợi ý tài liệu liên quan cho bạn