Nghiên cứu ứng dụng kỹ thuật phân tử xác định Phytoplasma gây bệnh trên cây mía (đính kèm bản word)

112 39 0
  • Loading ...
1/112 trang
Tải xuống

Thông tin tài liệu

Ngày đăng: 29/12/2018, 23:59

BỘ NÔNG NGHIỆP VÀ PHÁT TRIỂN NÔNG THÔN HỌC VIỆN NÔNG NGHIỆP HÀ NỘI VIỆN KHOA HỌC NÔNG NGHIỆP VIỆT NAM ***************************** NGÔ GIA BÔN NGHIÊN CỨU ỨNG DỤNG KỸ THUẬT PHÂN TỬ XÁC ðỊNH PHYTOPLASMA GÂY BỆNH TRÊN CÂY MÍA Chuyên ngành : Bảo vệ thực vật Mã số : 60.62.01.12 LUẬN VĂN THẠC SĨ NÔNG NGHIỆP Người hướng dẫn khoa học TS Trịnh Xuân Hoạt Hà Nội - 2014 LỜI CAM ðOAN Tơi xin cam đoan cơng trình nghiên cứu tơi với giúp đỡ tận tình TS Trịnh Xn Hoạt, Phó Viện trưởng Viện bảo vệ thực vật toàn thể anh /chị Nhóm nghiên cứu bệnh - Bộ mơn Chẩn đốn, Giám định dịch hại Thiên địch Các kết số liệu nêu luận văn hồn tồn trung thực Tác giả luận văn Ngơ Gia Bôn Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page i LỜI CẢM ƠN ðể hoàn thành luận văn nỗ lực thân, tơi nhận giúp ñỡ tận tình nhiều cá nhân tập thể Trước hết, Tơi xin bày tỏ lòng biết ơn sâu sắc ñến thầy hướng dẫn TS Trịnh Xuân Hoạt, Viện Bảo vệ thực vật, người tận tình bảo, hướng dẫn tơi thực hồn thành luận văn Tơi xin bày tỏ lòng biết ơn chân thành ñến thầy cô Ban ðào tạo sau ðại học-Viện KHNN Việt Nam ñã tạo ñiều kiện thuận lợi để tơi hồn thành học tập chương trình cao học hồn thành luận văn Tơi xin bày tỏ lòng biết ơn chân thành quan tâm thầy giáo hướng dẫn, giúp ñỡ nhiệt tình động viên lãnh đạo Viện Bảo vệ thực vật, lãnh đạo cán Bộ Mơn Chẩn ñoán giám ñịnh dịch hại thiên ñịch Viện Bảo vệ thực vật Cuối xin chân thành cảm ơn gia đình bạn bè tạo điều kiện thuận lợi, giúp đỡ tơi suốt q trình học tập nghiên cứu Một lần nữa, xin trân trọng cảm ơn! Hà Nội, ngày 20 tháng 12 năm 2014 Tác giả luận văn Ngô Gia Bôn Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page ii MỤC LỤC LỜI CAM ðOAN i LỜI CẢM ƠN ….ii DANH MỤC HIỆU VÀ CÁC CHỮ VIẾT TẮT v DANH MỤC BẢNG vi DANH MỤC HÌNH vii MỞ ðẦU CHƯƠNG 1: TỔNG QUAN TÀI LIỆU NGHIÊN CỨU 1.1 Cơ sở khoa học ñề tài 1.2 Tình hình sản xuất mía giới Việt Nam 1.2.1 Tình hình sản xuất mía đường giới 1.2.2 Tình hình sản xuất mía Việt Nam 1.2.3 Nguồn gốc lịch sử phát triển mía 1.2.4 Vị trí phân loại 1.2.5 ðặc ñiểm sinh trưởng 1.2.6 Giá trị kinh tế 1.3 Tổng quan nghiên cứu bệnh hại thực vật phytoplasma 1.3.1 Lịch sử nghiên cứu phytoplasma 1.3.2 Hình thái phytoplasma 1.3.3 Tầm quan trọng bệnh phytoplasma thực vật 10 1.3.4 Vị trí phân loại phytoplasma 10 1.3.5 Triệu chứng bệnh phytoplasma gây 16 1.3.7 Phát ñịnh loại phytoplasma gây bệnh thực vật 17 1.3.8 Những nghiên cứu bệnh phytoplasma hại mía 20 1.3.9 Biện pháp quản lý bệnh thực vật phytoplasma gây 22 1.4 Các nghiên cứu Phytoplasma hại trồng Việt Nam 24 CHƯƠNG 2:VẬT LIỆU, NỘI DUNG VÀ PHƯƠNG PHÁP NGHIÊN CỨU 25 2.1 Vật liệu ñịa ñiểm nghiên cứu 25 2.1.1 Vật liệu, dụng cụ nghiên cứu 25 Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nơng nghiệp Page iii 2.1.2 ðịa điểm nghiên cứu 25 2.2 Nội dung nghiên cứu 26 2.3 Phương pháp nghiên cứu 26 2.3.2 Phương pháp nghiên cứu xác ñịnh bệnh phytoplasma hại mía 27 CHƯƠNG 3: KẾT QUẢ NGHIÊN CỨU VÀ THẢO LUẬN 35 3.1 Kết ñiều tra phân bố gây hại nhóm bệnh phytoplasma gây hại mía 35 3.1.1 Kết ñiều tra thu thập mẫu bệnh Nghệ An 35 3.1.2 Triệu chứng bệnh phytoplasma gây hại mía 39 3.2 Kết nghiên cứu xác định bệnh phytoplasma gây hại mía 42 3.2.1 Kết xác định phytoplasmamía kính hiển vi điện tử 42 3.2.2 Xác định phytoplasmamía biểu triệu chứng bệnh chồi cỏ phương pháp PCR 44 3.2.3 Phân tích trình tự gen secA 70 KẾT LUẬN VÀ ðỀ NGHỊ 73 TÀI LIỆU THAM KHẢO 74 PHỤ LỤC 84 Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page iv DANH MỤC HIỆU VÀ CÁC CHỮ VIẾT TẮT Chữ viết tắt BVTV NS NXB Bp Chữ viết ñầy ñủ Bảo vệ thực vật Năng suất Nhà xuất base pairs Ca Phytoplasma Candidatus Phytoplasma CTAB DNA Cetyl Trimethyl Ammonium Bromide Deoxy Nucleic Acid RLFP RNA PCR Restriction Length Fragment Polymorphism Ribo Nucleic Acid Polymerase Chain Reaction SCGSD Sugarcane Grassy Shoot Disease SCWLD Sugarcane White Leaf Disease TE Tris-HCl EDTA TAE LAMP Tris-acetate acid EDTA Loop mediated isothermal Amplification FAO Food and Agriculture Organization Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page v DANH MỤC BẢNG TT bảng Tên bảng Trang 1.1 Tình hình sản xuất mía giới……………………… 1.2 Phân nhóm Phytoplasma dựa phân tích RFLP gene 16SrRNA………………………………………………… 11 2.1 Các cặp primer ñược sử dụng nghiên cứu…………… 33 3.1 Tình hình phát sinh bệnh chồi cỏ mía Nghệ An………… 37 3.2 Tỷ lệ bệnh chồi cỏ Huyện Tân Kỳ, Nghệ An năm 2012… 39 3.3 Kết chạy PCR cặp primer 55 3.4 Mức sai khác trình tự nucleotide SCGSNA so với 58 ñại diện nhóm Phytoplasma khác nhau…………… 3.5 Phytoplasma sử dụng phân tích phả hệ……………… 61 3.6 Phytoplasma sử dụng phân tích phả hệ……………… 67 Học viện Nơng nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page vi DANH MỤC HÌNH TT hình Tên hình Trang 2.1 Vị trí số primer đoạn gen 16-23SrRNA ……… 34 3.1 Sự phân bố bệnh chồi cỏ mía Nghệ An đánh dấu màu đỏ ………………………………………………… 36 3.2 Triệu chứng bệnh chồi cỏ mía Nghệ An ………………… 40 3.3 Triệu chứng bệnh chồi cỏ mía phát Ấn ðộ …… 41 3.4 Triệu chứng bệnh chồi cỏ mía phát Sri-Lanka 41 3.5 Triệu chứng điển hình bệnh trắng mía thu Bình 42 Dương ……………………………………………………… 3.6 Hình ảnh hiển vi điện tử chụp mơ mía biểu 43 không biểu triệu chứng chồi cỏ mía thu Nghệ An … 3.7 Phát Phytoplasmamía biểu triệu 44 chứng trắng ……………………………………………… 3.8 Kết sản phẩm PCR ñiều kiện nhiệt ñộ 500C ………… 45 3.9 Kết sản phẩm PCR ñiều kiện nhiệt ñộ 520C ………… 46 3.10 Kết sản phẩm PCR ñiều kiện nhiệt ñộ 550C ………… 46 3.11 Kết sản phẩm PCR ñiều kiện nhiệt ñộ 580C ………… 47 3.12 Kết sản phẩm PCR ñiều kiện nhiệt ñộ 600C ………… 47 3.13 Nested PCR sử dụng cặp primer P1/P7 R16mF2/R16mR1 48 để phát Phytoplasmamía ……………… Học viện Nơng nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page vii 3.14 Nested PCR sử dụng cặp mồi P1/P7 – R16F2/R16R2 ñể phát 49 Phytoplasmamía ………………………… 3.15 Nested PCR sử dụng cặp mồi P1/P7-R16F0/R16R0 ñể phát 50 Phytoplasmamía ………………………… 3.16 Nested PCR sử dụng cặp mồi P1/P7-R16F2N/R16R2 ñể phát 50 Phytoplasmamía ………………………… 3.17 Nested PCR sử dụng cặp mồi P1/P7-R16(I)F2/R16(I)R1 để 51 phát Phytopalsma mơ mía …………………… 3.18 Nested PCR sử dụng cặp mồi P1/P7-R16(III)F2/R16(III)R1 52 để phát Phytoplasmamía ……………… 3.19 Nested PCR sử dụng cặp mồi P1/P7-R16(V)F2/R16(V)R1 ñể 52 phát Phytoplasmamía …………………… 3.20 Nested-PCR sử dụng cặp primer P1/P7-R16F2n/R16R2 ñã 53 khuyếch ñại đoạn gen 16SrRNA Phytoplasmamía biểu triệu chứng chồi ………………………… 3.21 Sản phẩm PCR ñược thực phòng thí nghiệm ðại 54 học Tottingham, Vương quốc Anh ………………………… 3.22 Phân tích tính đa hình sản phẩm Nested-PCR 56 enzyme giới hạn …………………………………………… 3.23 Trình tự đoạn gen 16SrRNA Phytoplasma gây bệnh chồi 57 cỏ mía Nghệ An ………………………………………… 3.24 So sánh mức độ tương đồng trình tự gen 16SrRNA 60 Phytoplasma gây bệnh chồi cỏ mía Nghệ An-Việt Nam với Phytoplasma gây bệnh chồi cỏ mía Ấn ðộ phần mềm so sánh trình tự ClustalW2 …………………………… Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page viii 3.25 Cây phả hệ ñược xây dựng theo phương pháp Neighbor- 63 joining ……………………………………………………… 3.26 Sản phẩm nested-PCR với cặp primer P1/P7-R16F2n/R16R2 64 khuếch đại từ mẫu mía biểu triệu chứng trắng ……… 3.27 Sản phẩm nested-PCR ñã ñược cắt enzyme giới hạn 65 3.28 Trình tự gen 16SrRNA Phytoplasma gây bệnh trắng 66 mía Bình Dương………………………………………… 3.29 Cây phả hệ xây dựng theo phương pháp Neighbor- 69 joining ……………………………………………………… 3.30 Cây phả hệ thể mối tương quan Phytoplasma 71 gây bệnh mía cỏ dựa trình tự gen SecA ……… 3.31 Cây phả hệ thể mối tương quan Phytoplasma 72 gây bệnh mía cỏ dựa trình tự gen 16SrRNA …… Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page ix PHỤ LỤC DANH MỤC CÁC BÀI BÁO ðà ðĂNG Hoat TX, Thanh DVT, Dickinson M, Quan MV, Bon NG, Hien VD, Thanh ND and Vien NV (2012) Disease Problems of Sugarcane in Vietnam, with special reference with Phytoplasma Functional Plant Science and Biotechnology, 6(2), 117-123 Hoat TX, Bon NG, Quan MV, Thanh ND, Hien VD and Dickinson M (2012) Molecular Detection and characterization of a phytoplasma associated with sugarcane grassy shoot disease in Vietnam Phytoparasitica, 40(4), 351-359 Hoat TX, Nhung LTT, Thanh DVT, Bon NG, Duong CA and Nimal CK (2013) Molecular detection and identification of sugarcane white leaf phytoplasma in Vietnam International Sugar Journal, 1375, 505-511 Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nơng nghiệp Page 88 PHỤ LỤC PHA HĨA CHẤT THÍ NGHIỆM 1) CTAB 2% (dung dịch đệm tách chiết DNA tổng số): CTAB (Cexadexyl Trimethyl Ammonium Bromide): 0,2g Polyvinylpyrrolidone (MW 40000) : 2,0g 5M NaCl : 28,0 ml 0,5M EDTA (C10H16N2O8) pH8,0 :4,0ml 1M Tris-HCl pH8,0 :10,0ml Bổ sung nước cất hai lần vào vừa ñủ 100ml Beta-mecapto ethanol (chỉ cho vào trước dùng) : 2,0ml 2) Chloroform/isoamyl alcohol (24/1): Chloroform (CHCl3) : 24,0ml Iso amyl alcohol (CH3)2CHCH2CH2OH : 1,0ml 3) TE 1X (đệm hòa tan cặn DNA tổng số): Tris-HCl pH8,0 :10mM EDTA pH8,0 :1mM 4) 0,5M EDTA pH8,0: Disodium dihydrate (C10H18N2Na2O10) :93,05g Sodium hydroxide (NaOH) :9,0g Chuẩn ñộ pH8,0 với 10M NaOH Bổ sung nước cất hai lần vào vừa ñủ 500ml 5) 5M NaCl: Pha 146,1 g NaCl 500ml nước cất hai lần 6) 10M NaOH: Pha 200,0g NaOH 500ml nước cất hai lần Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page 89 7) TAE 50X (đệm hòa tan gel agarose chạy gel): Tris base (C4H11NO3) :242,2g Glacial acetic acid (C2H4O2) : 57,1ml 0,5M EDTA pH8,0 :100ml Bổ sung nước cất hai lần vào vừa đủ lít 8) Nhuộm gel với Ethidium bromide (EtBr): Cho 2ul EtBr (10mg/ml) 100ml ñệm TAE 1X Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page 90 PHỤ LỤC TRÌNH TỰ NUCLEOTIDE ðĂNG TRÊN NGÂN HÀNG GEN (GenBank) LOCUS JF928001 1198 bp DNA linear BCT 25-JUN- 2012 DEFINITION Sugarcane grassy shoot phytoplasma strain SCNAVN4 16S ribosomal RNA gene, partial sequence ACCESSION JF928001 VERSION JF928001.1 KEYWORDS SOURCE Sugarcane grassy shoot phytoplasma ORGANISM GI:336396677 Sugarcane grassy shoot phytoplasma Bacteria; Tenericutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Candidatus Phytoplasma REFERENCE AUTHORS (bases to 1198) Trinh,H.X., Ngo,B.G., Nguyen,T.D., Dang,T.V., Mai,Q.V., Vu,H.D.,Le,T., Le,N.T and Ngo,V TITLE Diversity of phytoplasmas in sugarcane and rice in Vietnam JOURNAL Unpublished REFERENCE AUTHORS (bases to 1198) Trinh,H.X., Ngo,B.G., Mai,Q.V., Nguyen,T.D., Dang,T.V., Le,N.T.,Le,T., Vu,H.D and Ngo,V V TITLE Direct Submission JOURNAL Submitted (09-MAY-2012) Plant Disease and Insect Pest Identification, Plant Protection Research Institute, Dongngac, Tuliem, Hanoi 84, Vietnam FEATURES source Location/Qualifiers 1198 /organism="Sugarcane grassy shoot phytoplasma" /mol_type="genomic DNA" /strain="SCNAVN4" /isolation_source="leaf" /host="Saccharum officinarum" Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page 91 /db_xref="taxon:345343" /country="Viet Nam" rRNA 1198 /product="16S ribosomal RNA" ORIGIN ggcatctttt tatttttaaa gacctttttc ggaaggtatg cttaaagagg ggcttgcgtc 61 acattagtta gttggcaggg taaaggccta ccaagactat gatgtgtagc tggacttgag 121 aggttgaaca gccacattgg gactgagaca cggcccaaac tcctacggga ggcagcagta 181 gggaattttc ggcaatggag gaaactctga ccgagcaacg ccgcgtgaac gatgaagtat 241 ttcggtatgt aaagttcttt tattgaagaa gaaaaaatag tggaaaaact atcttgacga 301 tattcaatga ataagccccg gcaaactatg tgccagcagc cgcggtaata catagggggc 361 gagcgttatt ccggaattat tgggcgtaaa gggtgcgtag gcggtttaat aagtctatag 421 tttaatttca gtgcttaaca ctgtcctgct atagaaacta ttagactaga gtgagataga 481 ggcaagtgga attccatgtg tagcggtaaa atgcgtaaat atatggagga acaccagagg 541 cgtaggcggc ttgctgggtc tttactgacg cctgaggcac gaaagcgtgg ggagcaaaca 601 ggattagata ccctggtagt cccacgccgt aaacgatgag tactaagtgt cgggattact 661 cggtactgaa gttaacacat taagtactcc gcctgagtta gtacgtacgc aagtatgaaa 721 cttaaaggaa ttgacgggac tccgcacaag cggtggatca tgttgtttaa ttcgaagata 781 cacgaaaaac cttaccaggt cttgacatac tctgcaaagc tatagcaata tagtggaggt 841 tatcagggat acaggtggtg catggttgtc gtcagctcgt gtcgtgagat gttaggttaa 901 gtcctaaaac gagcgcaacc cttgtcatta gttgccagca tgtcatgatg ggcactttaa 961 tgagactgcc aatgaaaaat ggaggaaggt gaggatcacg tcaaatcatc atgcccctta 1021 tgatctgggc tacaaacgtg atacaatggc tgttacaaag gagtagctga aaacggcaag 1081 tttttataac caaatctcaa taaaaaccgt ctcaagttcg ggatggaaag tcggcaaact 1141 ggacttccaa ggaaagtggg aatcgctaag gaaatcggga aaccaccatt cgcgggaa // LOCUS JF92800 1198 bp DNA linear BCT 25-JUN-2013 DEFINITION Sugarcane white leaf phytoplasma strain SCNAVN2 16S ribosomal RNA gene, partial sequence ACCESSION JF928000 VERSION JF928000.1 KEYWORDS SOURCE Sugarcane white leaf phytoplasma GI:336396676 Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page 92 ORGANISM Sugarcane white leaf phytoplasma Bacteria; Tenericutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Candidatus Phytoplasma; 16SrXI (Rice yellow dwarf group) REFERENCE AUTHORS (bases to 1198) Trinh,H.X., Ngo,B.G., Nguyen,T.D., Dang,T.V., Mai,Q.V., Vu,H.D.,Le,T., Le,N.T and Ngo,V TITLE Diversity of phytoplasmas in sugarcane and rice in Vietnam JOURNAL Unpublished REFERENCE AUTHORS (bases to 1198) Trinh,H.X., Ngo,B.G., Mai,Q.V., Nguyen,T.D., Dang,T.V., Le,N.T.,Vu,H.D., Le,T and Ngo,V TITLE Direct Submission JOURNAL Submitted (09-MAY-2013) Plant Disease and Insect Pest Identification, Plant Protection Research Institute, Dongngac,Tuliem, Hanoi 84, Vietnam FEATURES source Location/Qualifiers 1198 /organism="Sugarcane white leaf phytoplasma" /mol_type="genomic DNA" /strain="SCNAVN2" /isolation_source="leaf" /host="Saccharum officinarum" /db_xref="taxon:70613" /country="Viet Nam" rRNA 1198 /product="16S ribosomal RNA" ORIGIN ttggcatctt tttattttta aagacctttt tcggaaggta tgcttaaaga ggggcttgcg 61 tcacattagt tagttggcag ggtaaaggcc taccaagact atgatgtgta gctggacttg 121 agaggttgaa cagccacatt gggactgaga cacggcccaa actcctacgg gaggcagcag 181 tagggaattt tcggcaatgg aggaaactct gaccgagcaa cgccgcgtga acgatgaagt 241 atttcgggta tgtaaagttc ttttattgaa gaagaaaaaa tagtggaaaa actatcttga 301 cgatattcaa tgaataagcc ccggcaaact atgtgccagc agccgcggta atacataggg 361 ggcgagcgtt attccggaat tattgggcgt aaagggtgcg taggcggttt aataagtcta 421 tagtttaatt tcagtgctta acactgtcct gcttatagaa actattagac tagagtgaga Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page 93 481 tagaggcaag tggaattcca tgtgtagcgg taaaatgcgt aaatatatgg aggaacacca 541 gaggcgtagg cggcttgctg ggtctttact gacgctgagg cacgaaagcg tggggagcaa 601 acaggattag ataccctggt agtccacgcc gtaaacgatg agtactaagt gtcgggatta 661 ctcggtactg aagttaacac attaagtact ccgcctgagt aggtacgtac gcaagtatga 721 aacttaaagg aattgacggg actccgcaca agcggtggat catgttgttt aattcgaaga 781 tacacgaaaa accttaccag gtcttgacat actctgcaaa gctatagcaa tatagtggag 841 gttatcaggg atacaggtgg tgcatggttg tcgtcagctc gtgtcgtgag atgttaggtt 901 aagtcctaaa acgagcgcaa cccttgtcat tagttgccag catgtcatga tgggcacttt 961 aatgagactg ccaatgaaaa attggaggaa ggtgaggatc acgtcaaatc atcatgcccc 1021 ttatgatctg ggctacaaac gtgatacaat ggctgttaca aagagtagct gaaacgcaag 1081 ttttatacca aatctcataa aaagccaagt ctcaagttcg ggatggaagt ctgcaaactg 1141 gacttccatg aaagtgggaa tcgctaaggt aaatcgcgat atccaccatt cgcgggaa// LOCUS JN127376 1113 bp DNA linear BCT 18-JUL-2012 DEFINITION Sugarcane white leaf phytoplasma strain SCWLBDVN 16S ribosomal RNA gene, partial sequence ACCESSION JN127376 VERSION JN127376.1 KEYWORDS SOURCE Sugarcane white leaf phytoplasma ORGANISM GI:339831919 Sugarcane white leaf phytoplasma Bacteria; Tenericutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Candidatus Phytoplasma; 16SrXI (Rice yellow dwarf group) REFERENCE (bases to 1113) AUTHORS Ngo,B.G., Nguyen,T.D and Trinh,H.X TITLE Detection and characterization of a phytoplasma associated with sugarcane white leaf disease in southern Vietnam JOURNAL REFERENCE Unpublished (bases to 1113) AUTHORS Ngo,B.G., Nguyen,T.D and Trinh,H.X TITLE Direct Submission Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page 94 JOURNAL Submitted (15-JUN-2012) Plant Disease and Pest Identification,Plant Protection Research Institute, Dong Ngac, Tu Liem, Ha Noi 84, Viet Nam FEATURES source Location/Qualifiers 1113 /organism="Sugarcane white leaf phytoplasma" /mol_type="genomic DNA" /strain="SCWLBDVN" /isolation_source="leaf" /host="Saccharum officinarum (sugarcane)" /db_xref="taxon:70613" /country="Viet Nam" /collected_by="Ngo Gia Bon" rRNA 1113 /product="16S ribosomal RNA" ORIGIN taaagacctt tttcggaagg tatgcttaaa gaggggcttg cgtcacatta gttagttggc 61 agggtaaaag cctaccaaga ctatgatgtg tagctggacc tgagaggttg aacagccaca 121 ttgggactga gacacggccc aaactcctac gggaggcagc agtagggaat tttcggcaat 181 ggaggaaact ctgaccgagc aacgccgcgt gaacgatgaa gtattttcgg tatgtaaagt 241 tcttttattg aagaagaaaa aatagtggaa aaactatctt gacgatattc aatgaataag 301 ccccggcaaa ctatgtgcca gcagccgcgg taatacatag ggggcgagcg ttatccggaa 361 ttattgggcg taaagggtgc gtaggcggtt taataagtct atagtttaat ttcagtgctt 421 aacactgtcc tgctatagaa actattagac tagagtgaga tagaggcaag tggaatttcc 481 atgtgtagcg gtaaaatgcg taaatatatg gaggaacacc agaggcgtag gcggcttgct 541 gggtctttac tgacgctgag gcacgaaagc gtggggagca aacaggatta gataccctgg 601 tagtccacgc cgtaaacgat gagtactaag tgtcgggatt actcggtact gaagttaaca 661 cattaagtac tccgcctgag tagtacgtac gcaagtatga aacttaaagg aattgacggg 721 actccgcaca agcggtggat catgttgttt aattcgaaga tacacgaaaa accttaccag 781 gtcttgacat actctgcaaa gctataggca atatagtgga ggttatcagg gatacaggtg 841 gtgcatggtt gtcgtcagct cgtgtcgtga gatgttaggt taagtcctaa aacgagcgca 901 acccttgtca ttagttgcca gcatgtcatg atggggcact ttaatgagac tgccaatgaa 961 aaattggagg aaggtgagga tcacgtcaaa tcatcatgcc ccttatgatc tgggctacaa 1021 acgtgataca atggctgtta caaagagtag ctgaaacgta agtttatagc caatctcata 1081 aaagcagtct cagttcggat tgaagtctgc aac// Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page 95 LOCUS KC295286 1263 bp DNA linear BCT 22-JAN-2013 DEFINITION Sugarcane white leaf phytoplasma strain DNAI-NTTT.2012 16S ribosomal RNA gene, partial sequence ACCESSION KC295286 VERSION KC295286.1 KEYWORDS SOURCE Sugarcane white leaf phytoplasma ORGANISM GI:442736177 Sugarcane white leaf phytoplasma Bacteria; Tenericutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Candidatus Phytoplasma; 16SrXI (Rice yellow dwarf group) REFERENCE AUTHORS (bases to 1263) Nguyen,T.D., Mai,Q.V., Vu,H.D., Ngo,B.G., Ha,C.V and Trinh,H.X TITLE Detection and identification of phytoplasmas in Viet Nam JOURNAL Unpublished REFERENCE AUTHORS (bases to 1263) Nguyen,T.D., Mai,Q.V., Vu,H.D., Ngo,B.G., Ha,C.V and Trinh,H.X TITLE Direct Submission JOURNAL Submitted (07-DEC-2012) Plant Diseases Diagnotics, Plant Protection Research Institute (PPRI), Dong Ngac-Tu Liem-Ha Noi, Hanoi, Hanoi 084, Vietnam FEATURES source Location/Qualifiers 1263 /organism="Sugarcane white leaf phytoplasma" /mol_type="genomic DNA" /strain="DNAI-NTTT.2012" /isolation_source="symptomatic plant" /host="Saccharum officinarum" /db_xref="taxon:70613" Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page 96 /country="Viet Nam" /collection_date="2012" rRNA 1263 /product="16S ribosomal RNA" ORIGIN tgacgatggt aacaattgga aacagttgct aagactggat aggaaataaa aaggcatctt 61 tttattttta aaagaccttt ttcggaaggt atgcttaaag aggggcttgc gtcacattag 121 ttagttggca gggtaaaagc ctaccaagac tatgatgtgt agctggactg agaggttgaa 181 cagccacatt gggactgaga cacggcccaa actcctacgg gaggcagcag tagggaattt 241 tcggcaatgg aggaaactct gaccgagcaa cgccgcgtga acgatgaagt atttcggtat 301 gtaaagttct tttattgaag aagaaaaaat agtggaaaaa ctatcttgac gatattcaat 361 gaataagccc cggcaaacta tgtgccagca gccgcggtaa tacatagggg gcgagcgtta 421 tccggaatta ttgggcgtaa agggtgcgta ggcggtttaa taagtctata gtttaatttc 481 agtgcttaac actgtcctgc tatagaaact attagactag agtgagatag aggcaagtgg 541 gaattccatg tgtagcggta aaatgcgtaa atatatggag ggaacaccag aggcgtaggc 601 ggcttgctgg gtctttactg acgctgaggc acgaaagcgt ggggagcaaa caggattaga 661 taccctggta gtccacgccg taaacgatga gtactaagtg tcggggatta ctggttaact 721 gaagttaaca cattaaggta ctccggcgtg agtagtacgt acgcagtatg aaacttaaag 781 gaattgacgg gactccgcac aagcggtgga tcatgttgtt taattcgaag atacacgaaa 841 aaccttacca ggtcttgaca tactctgcaa agctatagca atatagtgga ggttatcagg 901 gatacaggtg gtgcatggtt gtcgtcagct cgtgtcgtga gatgttaggt taagtcctaa 961 aacgagcgca acccttgtca ttagttgcca gcatgtcatg atggcacttt aatgagactg 1021 ccaatgaaaa attggaggaa ggtgaggatc acgtcaaatc atcatgcccc ttatgatctg 1081 ggctacaaac gtgatacaat ggctgttaca aagagtagct gaaacgtaag tttatagcca 1141 atctcataaa agcagtctca gttcggattg aagtctgcaa ctcgacttca tgaagttgga 1201 atcgctgtaa tcgcgaatca gcatgtcgcg gtgaatacgt tctcggggtt tgtacacacc 1261 gcc Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page 97 LOCUS JF754458 266 bp DNA linear BCT 01-AUG-2012 DEFINITION Sugarcane grassy shoot phytoplasma isolate SCGS2V secA (secA) gene, partial cds ACCESSION JF754458 VERSION JF754458.1 KEYWORDS SOURCE Sugarcane grassy shoot phytoplasma ORGANISM GI:381413006 Sugarcane grassy shoot phytoplasma Bacteria; Tenericutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Candidatus Phytoplasma REFERENCE (bases to 266) AUTHORS Abeysinghe,S., Abeysinghe,P.D., Trinh Xuan,H and Dickinson,M TITLE Sugarcane phytoplasma sequences JOURNAL Unpublished REFERENCE (bases to 266) AUTHORS Abeysinghe,S., Abeysinghe,P.D., Trinh Xuan,H and Dickinson,M TITLE Direct Submission JOURNAL Submitted (01-APR-2011) School of Biosciences, University of Nottingham, Sutton Bonington Campus, Loughborough, Leics LE12 5RD, UK FEATURES source Location/Qualifiers 266 /organism="Sugarcane grassy shoot phytoplasma" /mol_type="genomic DNA" /isolate="SCGS2V" /db_xref="taxon:345343" /country="Viet Nam" /collection_date="2010" /collected_by="H Trinh Xuan" gene 266 /gene="secA" CDS 266 /gene="secA" /codon_start=1 /transl_table=11 /product="secA" Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page 98 /protein_id="AFG28549.1" /db_xref="GI:381413007" /translation="KKFYMDANRFAKILKPHHYIIDLEANSIELTEEGIKKGENFFKI PNLYDSNNIVLLHCIKNALKAHFIMNKNKDYLVYKNNVLIIDQFT" misc_feature 266 /gene="secA" /note="SecA preprotein cross-linking domain; Region: SecA_PP_bind; pfam01043" /db_xref="CDD:250319" ORIGIN aaaaagtttt atatggatgc taatcgtttt gctaaaattt taaaacctca tcattatatt 61 attgatttag aagctaatag tattgaattg acagaagaag ggataaaaaa aggtgaaaac 121 tttttcaaaa ttcctaattt atatgatagc aataatattg ttttattgca ttgtataaaa 181 aatgctttaa aggcccattt tattatgaat aaaaataaag attatttagt atataaaaat 241 aatgttttga taatagatca atttac// LOCUS JF754457 266 bp DNA linear BCT 01-AUG-2012 DEFINITION Sugarcane grassy shoot phytoplasma isolate SCGS1V secA (secA) gene, partial cds ACCESSION JF754457 VERSION JF754457.1 KEYWORDS SOURCE Sugarcane grassy shoot phytoplasma ORGANISM GI:381413004 Sugarcane grassy shoot phytoplasma Bacteria; Tenericutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Candidatus Phytoplasma REFERENCE (bases to 266) AUTHORS Abeysinghe,S., Abeysinghe,P.D., Trinh Xuan,H and Dickinson,M TITLE Sugarcane phytoplasma sequences JOURNAL Unpublished REFERENCE (bases to 266) Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page 99 AUTHORS Abeysinghe,S., Abeysinghe,P.D., Trinh Xuan,H and Dickinson,M TITLE Direct Submission JOURNAL Submitted (01-APR-2011) School of Biosciences, University of Nottingham, Sutton Bonington Campus, Loughborough, Leics LE12 5RD,UK FEATURES source Location/Qualifiers 266 /organism="Sugarcane grassy shoot phytoplasma" /mol_type="genomic DNA" /isolate="SCGS1V" /db_xref="taxon:345343" /country="Viet Nam" /collection_date="2010" /collected_by="H Trinh Xuan" gene 266 /gene="secA" CDS 266 /gene="secA" /codon_start=1 /transl_table=11 /product="secA" /protein_id="AFG28548.1" /db_xref="GI:381413005" /translation="KKFYMDANRFAKILKPHHYIIDLEANSIELTEEGIKKGENFFKI PNLYDSNNIVLLHCIKNALKAHFIMNKNKDYLVYKNNVLIIDQFT" misc_feature 266 /gene="secA" /note="SecA preprotein cross-linking domain; Region: SecA_PP_bind; pfam01043" /db_xref="CDD:250319" ORIGIN aaaaagtttt atatggatgc taatcgtttt gctaaaattt taaaacctca tcattatatt 61 attgatttag aagctaatag tattgaattg acagaagaag ggataaaaaa aggtgaaaac 121 tttttcaaaa ttcctaattt atatgatagc aataatattg ttttattgca ttgtataaaa 181 aatgctttaa aggcccattt tattatgaat aaaaataaag attatttagt atataaaaat 241 aatgttttga taatagatca atttac // Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page 100 LOCUS JF754442 773 bp DNA linear BCT 01-AUG-2012 DEFINITION Sugarcane grassy shoot phytoplasma isolate SCGS1V 16S ribosomal RNA gene, partial sequence ACCESSION JF754442 VERSION JF754442.1 KEYWORDS SOURCE Sugarcane grassy shoot phytoplasma ORGANISM GI:381412982 Sugarcane grassy shoot phytoplasma Bacteria; Tenericutes; Mollicutes; Acholeplasmatales; Acholeplasmataceae; Candidatus Phytoplasma REFERENCE (bases to 773) AUTHORS Abeysinghe,S., Abeysinghe,P.D., Trinh Xuan,H and Dickinson,M TITLE Sugarcane phytoplasma sequences JOURNAL Unpublished REFERENCE (bases to 773) AUTHORS Abeysinghe,S., Abeysinghe,P.D., Trinh Xuan,H and Dickinson,M TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) School of Biosciences, University of Nottingham, Sutton Bonington Campus, Loughborough, Leics LE12 5RD, UK FEATURES source Location/Qualifiers 773 /organism="Sugarcane grassy shoot phytoplasma" /mol_type="genomic DNA" /isolate="SCGS1V" /db_xref="taxon:345343" /country="Viet Nam" /collection_date="2010" /collected_by="H Trinh Xuan" rRNA 773 /product="16S ribosomal RNA" ORIGIN gagcaacgcc gcgtgaacga tgaagtattt cggtatgtaa agttctttta ttgaagaaga 61 aaaaatagtg gaaaaactat cttgacgata ttcaatgaat aagccccggc aaactatgtg 121 ccagcagccg cggtaataca tagggggcga gcgttatccg gaattattgg gcgtaaaggg 181 tgcgtaggcg gtttaataag tctatagttt aatttcagtg cttaacactg tcctgctata Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page 101 241 gaaactatta gactagagtg agatagaggc aagtggaatt ccatgtgtag cggtaaaatg 301 cgtaaatata tggaggaaca ccagaggcgt aggcggcttg ctgggtcttt actgacgctg 361 aggcacgaaa gcgtggggag caaacaggat tagataccct ggtagtccac gccgtaaacg 421 atgagtacta agtgtcggga ttactcggta ctgaagttaa cacattaagt actccgcctg 481 agtagtacgt acgcaagtat gaaacttaaa ggaattgacg ggactccgca caagcggtgg 541 atcatgttgt ttaattcgaa gatacacgaa aaaccttacc aggtcttgac atactctgca 601 aagctatagc aatatagtgg aggttatcag ggatacaggt ggtgcatggt tgtcgtcagc 661 tcgtgtcgtg agatgttagg ttaagtccta aaacgagcgc aacccttgtc attagttgcc 721 agcatgtcat gatgggcact ttaatgagac tgccaatgaa aaattggagg aag// Học viện Nông nghiệp Việt Nam – Luận văn Thạc sỹ Khoa học Nông nghiệp Page 102 ... 16SrIII: X-disease III-A Western X-disease (WX) Kirkpatrick, 2003 III-B Clover yellow edge (CYE) L33766 Gundersen et al.,1994 III-C Pecan bunch (PB) EF186807 Martini et al., 2007 III-D Goldenrod... yellows VII-A VII-B 16SrVIII: Loofah witches’ broom VIII-A Loofah witches’ broom (LufWB) 16SrIX: Pigeon pea witches’ broom IX-A Pigeon pea witches’-broom (PPWB) AF248957 Davis & Dally, 2000 IX-C Naxos... yellows (ALY882) AY197642 Lee et al., 2004b V-C Flavescence dorée (FD-C) X76560 Daire et al., 1992 V-D Flavescence dorée (FD-D) AJ548787 Torres et al., 2005 V-E Rubus stunt (RuS) Y16395 Seemüller et
- Xem thêm -

Xem thêm: Nghiên cứu ứng dụng kỹ thuật phân tử xác định Phytoplasma gây bệnh trên cây mía (đính kèm bản word), Nghiên cứu ứng dụng kỹ thuật phân tử xác định Phytoplasma gây bệnh trên cây mía (đính kèm bản word)

Từ khóa liên quan

Gợi ý tài liệu liên quan cho bạn

Nhận lời giải ngay chưa đến 10 phút Đăng bài tập ngay