Xây dựng PROBE để khai thác và chọn gen mã hóa XYLAN 1 4 BETA XYLOSIDASE từ dữ liệu giải trình tự DNA METAGENOME

50 49 0
  • Loading ...
1/50 trang

Thông tin tài liệu

Ngày đăng: 22/03/2018, 19:48

VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC KHÓA LUẬN TỐT NGHIỆP ĐỀ TÀI: XÂY DỰNG PROBE ĐỂ KHAI THÁC VÀ CHỌN GEN MÃ HÓA XYLAN 1-4 BETA XYLOSIDASE TỪ DỮ LIỆU GIẢI TRÌNH TỰ DNA METAGENOME Giáo viên hướng dẫn Sinh viên thực Lớp Hà Nội - 2017 :TS.Nguyễn Thị Trung :Vũ Trường Đức :1302 – K20 VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC KHÓA LUẬN TỐT NGHIỆP ĐỀ TÀI: XÂY DỰNG PROBE ĐỂ KHAI THÁC VÀ CHỌN GEN MÃ HÓA XYLAN 1-4 BETA XYLOSIDASE TỪ DỮ LIỆU GIẢI TRÌNH TỰ DNA METAGENOME Giáo viên hướng dẫn :TS Nguyễn Thị Trung Sinh viên thực :Vũ Trường Đức Lớp :13.02 - K20 Hà Nội - 2017 VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC LỜI CẢM ƠN Em xin bày tỏ lòng biết ơn chân thành tới giảng viên hướng dẫn - TS Nguyễn Thị Trung - người định hướng nghiên cứu, tận tình giúp đỡ em trình thực đề tài Em xin bày tỏ lòng biết ơn chân thành tới GS.TS Trương Nam Hải, TS Đỗ Thị Huyền - Trưởng phòng Kỹ thuật di truyền, Th.S Lê Ngọc Giang nghiên cứu sinh phòng kĩ thuật di truyền, tồn thể (chú), anh (chị) kỹ thuật viên Phòng kỹ thuật di truyền tận tình giúp đỡ, tạo điều kiện tốt để giúp em hoàn thành đề tài Em xin gửi lời cảm ơn chân thành tới thầy (cô) giáo khoa Công Nghệ Sinh Học, trường Viện Đại Học Mở Hà Nội truyền đạt cho em kiến thức quý báu thơi gian học tập vừa qua Trong trình nghiên cứu đề tài, thời gian thực tập có hạn, kiến thức em hạn chế nên báo cáo em khơng tránh khỏi thiếu sót định Em mong nhận đóng góp ý kiến giảng viên hướng dẫn – TS Nguyễn Thị Trung, thầy (cô) giáo khoa Công Nghệ Sinh Học trường Viện Đại học Mở Hà Nội cô chú, anh chị kỹ thuật viên phòng kỹ thuật di truyền để viết em hoàn thiện Em xin chân thành cảm ơn ! Hà Nội, ngày 09 tháng 05 năm 2017 Sinh viên Vũ Trường Đức Vũ Trường Đức – 1302.K20 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC MỤC LỤC DANH MỤC CÁC CHỮ VIẾT TẮT I DANH MỤC CÁC BẢNG II DANH MỤC CÁC HÌNH III LỜI MỞ ĐẦU PHẦN 1: TỔNG QUAN 1.1 Khái quát xylan 1-4 beta xylosidase 1.1.1 Định nghĩa 1.1.2 Phân loại 1.1.3 Hoạt tính xylan 1-4 beta xylosidase 1.1.4 Cấu trúc xylan 1-4 beta xylosidase 1.1.4.1 Cấu trúc bậc I xylan 1-4 beta xylosidase 1.1.4.2 Cấu trúc bậc II xylan 1-4 beta xylosidase 1.1.4.3 Cấu trúc bậc xylan 1-4 beta xylosidase 1.1.4.4 Cấu trúc bậc IV xylan 1-4 beta xylosidase 1.2 Khái quát enzyme hoạt hóa carbohydrate (CAZy) 1.2.1 Khái niệm enzyme hoạt hóa carbohydrate (CAZy) 1.2.2 Lịch sử phát triển enzyme hoạt hóa carbohydrate 1.3 Khai thác sở liệu gen 1.3.1 Khai thác liệu từ Ngân hàng Gen quốc tế 1.3.1.1 Khái niệm sở liệu gen 1.3.1.2 Phương pháp tìm kiếm thơng tin gen Vũ Trường Đức – 1302.K20 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC 1.3.1.3 Một số phần mềm hỗ trợ tìm kiếm thơng tin gen 1.3.2 Sử dụng Probe 10 1.3.2.1 Khái niệm Probe 10 1.3.2.2 Cấu trúc probe 11 1.3.2.3 Phương pháp xây dựng probe 11 1.4 Cơ sở liệu DNA metagenome vi sinh ruột mối 12 PHẦN II: VẬT LIỆU VÀ PHƯƠNG PHÁP NGHIÊN CỨU 13 2.1 Vật liệu nghiên cứu 13 2.1.1 Đối tượng nghiên cứu 13 2.1.2 Thiết bị nghiên cứu 13 2.2 Phương pháp nghiên cứu 13 2.2.1 Xác định họ GH có chứa enzyme xylan 1-4 beta xylosidase theo CAZy 13 2.2.2 Tìm kiếm trình tự axit amin enzyme xylan 1-4 beta xylosidase xác định đặc tính 14 2.2.3 Xác định mức độ tương đồng trình tự ClustalW PBIL 15 2.2.4 Xây dựng probe giá trị tham chiếu 16 2.2.5 Khai thác trình tự mã hóa xylan 1-4 beta xylosidase từ liệu DNA metagenome vi sinh vật ruột mối 17 PHẦN III: KẾT QUẢ VÀ THẢO LUẬN 18 3.1 Các họ GH có chứa enzyme xylan 1-4 beta xylosidase theo CAZy 18 Vũ Trường Đức – 1302.K20 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC 3.1.1 Số lượng họ GH có chứa enzyme xylan 1-4 beta xylosidase theo CAZy 18 3.1.2 Cấu trúc đặc trưng số họ GH có chứa enzyme xylan 1-4 beta xylosidase theo CAZy 19 3.2 Trình tự axit amin enzyme xylan 1-4 beta xylosidase xác định đặc tính 20 3.3 Mức độ tương đồng trình tự axit amin 26 3.4 Xây dựng probe giá trị tham chiếu 27 3.5 Khai thác trình tự mã hóa cho enzyme xylan 1-4 beta xylosidase probe từ liệu DNA metagenome vi sinh vật ruột mối 29 3.6 Khảo sát cấu trúc bậc trình tự axit amin enzym xylan 14 beta xylosidase khai thác probe 32 PHẦN IV: KẾT LUẬN VÀ KIẾN NGHỊ 38 4.1 Kết luận 38 4.2 Kiến nghị 38 TÀI LIỆU THAM KHẢO 39 Vũ Trường Đức – 1302.K20 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC BẢNG KÝ HIỆU VÀ CHỮ VIẾT TẮT Chữ viết tắt BLAST Chú thích Basic Local Alignment Search Tool CAZy Carbohydrate-Active enZymes DNA Deoxyribonucleic acid EC Enzym classes GH Glycoside Hydrolases NCBI National Center for Biotechnology Information RNA Ribonucleic acid Vũ Trường Đức – 1302.K20 I Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC DANH MỤC CÁC BẢNG Bảng 3.1 Các họ GH chứa enzyme xylan 1-4 beta xylosidase theo CAZy Bảng 3.2 Tổng hợp liệu nghiên cứu chi tiết xylan 1-4 beta xylosidase Bảng 3.4 So sánh tương đồng probe với trình tự thuộc GH43 Bảng 3.5.1 So sánh số lượng trình tự khai thác probe với dự đoán BGI Bảng 3.5.2 So sánh số lượng trình tự khai thác probe với dự đoán BGI Bảng 3.6 Ước đốn cấu trúc bậc ba trình tự Swiss Prot Vũ Trường Đức – 1302.K20 II 18 20 28 29 31 33 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC DANH MỤC CÁC HÌNH Hình 1.1 Cấu trúc bậc enzyme β-xylosidase tách từ Thermoanaerobacterium saccharolyticum JW/SL-YS485 có khối lượng 73 kDa Hình 1.2 Cấu trúc bậc beta-1,4-xylanases from Chaetomium thermophilum Hình 1.3 Cấu trúc bậc enzyme β-xylosidase tách từ Thermoanaerobacterium saccharolyticum JW/SL-YS485 Hình 3.3 Kết so sánh tương đồng trình tự axit amin 26 xylan 1-4 beta xylosidase thuộc họ GH43 Hình 3.4 Trình tự probe cho enzyme xylan 1-4 beta xylosidase thuộc 27 họ GH43 Hình 3.5 Kết dự đốn tương đồng đặc hiệu trình tự gốc 32 hoạt động trình tự lựa chọn probe GH43 Hình 3.6 Cấu trúc bậc ba xylan beta xylosidase khuôn (template) 2exk.1.A (A), 1yrz.1.A (B), 1yi7.1.A (C), 3c7g.1.A (D) họ 37 GH43 tương đồng với trình tự khai thác probe sử dụng Swiss prot Vũ Trường Đức – 1302.K20 III Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC LỜI MỞ ĐẦU Mối Coptotermes gestroi thuộc mối bậc thấp họ Rhinotermitidae phổ biến Việt Nam số quốc gia giới Có 16 họ GH vi sinh vật cộng sinh ruột sau bao gồm: GH2, 3, 5, 7, 10, 11, 16, 20, 26, 30, 42, 45, 47, 53, 77, 92 Ứng dụng kỹ thuật metagenomics theo hướng phân tích liệu thu từ việc giải tồn trình tự metagenome, Do đồng tác giả khai thác 125.431 khung đọc mở (ORF) với tổng chiều dài lên tới 78.271.365 bp hệ vi khuẩn sống tự ruột mối, ước đốn gồm nhiều trình tự mã hóa cho enzyme xylan 1-4 beta xylosidase hay gọi tắt enzyme beta xylosidase Phương pháp dự đoán gen từ liệu khổng lồ DNA metagenome vi sinh vật ruột mối bước đầu sử dụng phần mềm tin sinh học, thường dựa số liệu trình tự tương đồng với lồi cơng bố ngân hàng gen Việc lựa chọn trình tự gen mong muốn thực nhiều phần mềm dự đoán cấu trúc chức protein Đầu tiên việc sử dụng công cụ BLASTP để xác định chức cách so sánh độ tương đồng mức độ bao phủ trình tự ước đoán chức ban đầu từ DNA metagenome, với trình tự có ngân hàng gen NCBI Kết BLASTP giúp cho việc ước đoán nhiều thơng số enzyme vị trí vùng bảo tồn, họ enzyme, nguồn vi sinh vật chứa enzyme, … Trước đưa vào thực nghiệm, gen tiếp tục sử dụng phần mềm dự đốn tính chất khả chịu kiềm/axit, chịu nhiệt ,… enzyme Mặc dù liệu trình tự axit amin/nucleotit NCBI vơ lớn, có nhiều trình tự nucleotit mã hóa cho enzyme xylan 1-4 beta xylosidase chưa nghiên cứu tính chất, mà dựa so sánh tương đồng trình tự có sẵn NCBI Do số liệu dự đốn BLAST phần mềm khác sử dụng liệu NCBI chưa nghiên cứu chi tiết trở nên tin cậy Vũ Trường Đức – 1302.K20 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CƠNG NGHỆ SINH HỌC Hình 3.3 Kết so sánh tương đồng trình tự axit amin xylan 14 beta xylosidase thuộc họ GH43 Trình tự Prim Cons tơ màu trình tự dùng làm probe Mức độ bảo thủ gốc axit amin đánh dấu từ dấu * đến dấu ":" dấu "." không đánh dấu Theo kết tính tốn so sánh 11 trình tự axit amin thu thập có axit amin hồn tồn giống nhau, 32 vị trí giống đa số trình tự có 30 vị trí giống số trình tự, lại khác Kết cho thấy trình tự mã hóa enzyme xylan 1-4 beta xylosidase thuộc họ GH43 vi khuẩn bảo tồn cao 3.4 Xây dựng probe giá trị tham chiếu Sau so sánh, vị trí giống lựa chọn để làm probe vị trí khác nhiều loại bỏ (Hình 3.4) IXNPVLKGFNPDPSICRVGEDYYIAXSTFEWFPGVXIXHSKDLVNW RLXXRPLXRXSQLDMKGNPDSGGVWAPCLSYXDGKFWLIYTDV KVVDGPWKDGHNYLVTADDIDGPWSPEPXPLNSSGFDPSLFHDDD GXKYLLNMLWGHREGHHSFGGIVXQEFSVAEKKLVGERKIIFXG TPXKLTEAPHLYKIXGYYYLLTAEGGTRYEHAVTVARSKXIXGPY EVHPDNPILTSXHXPEXPLQKXGHASIVXTHTGEWYLAHLTGRPI PTPPGYRGYCPLGRETAIQKLEWKDDGWPYVGGGKELEVEXPR Vũ Trường Đức – 1302.K20 27 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC YIXEHPXXXTYXEVDEFDDXTLNXHFQTLRIPFTEQGSLTERPGHL RLYGREKSLTSFTQAFVARRWQHFXFTAETAFKPTFQQSAGLVN YYNTENWLQVTYDETAGGRXLVCDNLVSQPLDDIYVYLRVVDRE TYKYSYSFDGEWKIPVPLESTKLSDYIRGGFFTGAFVGLXCXYDXS GXGLPADFDYFXYEEX Hình 3.4 Trình tự probe cho enzyme xylan 1-4 beta xylosidase thuộc họ GH43 X: gốc axit amin khơng xác định Để tìm giá chị tham chiếu cho việc sử dụng probe khai thác gen, chúng em so sánh tương đồng probe với trình tự sử dụng để xây dựng nên chúng Kết thu được trình bày Bảng 3.4 Bảng 3.4 So sánh tương đồng probe với trình tự thuộc GH43 Trình tự Điểm tối đa Tổng điểm Độ bao phủ Giá trị E Độ tương đồng Trình tự 608 608 100% 0.0 72% Trình tự 603 603 99% 0.0 71% Trình tự 444 444 99% 5e-155 56% Trình tự 596 596 99% 0.0 71% Trình tự 231 248 99% 2e-73 37% Trình tự 547 547 99% 0.0 66% Trình tự 11 351 351 99% 4e-119 49% Trình tự 10 358 377 98% 9e-122 51% Trình tự 101 134 83% 3e-27 30% Vũ Trường Đức – 1302.K20 28 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI Trình tự KHOA CƠNG NGHỆ SINH HỌC Điểm tối đa Tổng điểm Độ bao phủ Giá trị E Độ tương đồng Trình tự 25.8 76.2 61% 0.003 33% Trình tự 17.3 113 60% 1.2 46% Kết Bảng 3.4 cho thấy để khai thác triệt để trình tự mã hóa xylan 1-4 beta xylosidase GH43 phải có điểm tối đa 17,3 độ bao phủ độ tương đồng tối thiểu 60% 30% so với probe Sử dụng probe tạo để khai thác trình tự gen cho thấy probe phù hợp với trình tự số 1, 2, 3, 6, 7, 8, 10, 11 (chỉ số điểm tối đa 101, độ tương đồng 37%) không đại diện tốt cho trình tự số 4, 5, số điểm tối đa thấp độ tương đồng thấp Như vậy, sử dụng probe để khai thác gen, trình tự có điểm tối đa cao 200 độ tương đồng cao 37% ưu tiên lựa chọn 3.5 Khai thác trình tự mã hóa cho enzyme xylan 1-4 beta xylosidase probe từ liệu DNA metagenome vi sinh vật ruột mối Dựa liệu KEGG, công ty BGI giải 46 trình tự có hoạt tính xylan 1-4 beta xylosidase thuộc họ GH43 Khi sử dụng probe, sử dụng số điểm tối đa 17, độ bao phủ độ tương đồng tối thiểu 60% 30% chúng em lựa chọn 25 trình tự có 20 trình tự trùng với dự đốn BGI (Bảng 3.5.1) Bảng 3.5.1 So sánh số lượng trình tự khai thác probe với dự đoán BGI Vũ Trường Đức – 1302.K20 29 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI Kết khai thác Probe Kết dự đốn BGI KHOA CƠNG NGHỆ SINH HỌC Mã gen Điểm Tổng Độ bao Giá trị Độ tối đa điểm phủ E tương GL0104795 GL0104795 382 382 99% 1e-130 đồng 48% GL0020896 GL0020896 285 285 62% 3e-96 54% GL0117445 GL0117445 285 285 62% 3e-96 54% GL0076106 GL0076106 243 259 85% 2e-77 38% GL0006405 GL0006405 227 271 58% 7e-75 57% GL0044986 GL0044986 225 256 87% 7e-72 37% GL0077826 GL0077826 216 265 67% 9e-70 48% GL0112518 GL0112518 216 265 67% 9e-70 48% GL0001262 GL0001262 214 266 82% 8e-67 35% GL0095948 GL0095948 173 173 63% 3e-53 39% GL0015489 GL0015489 161 182 67% 2e-49 42% GL0088906 GL0088906 154 193 52% 2e-48 53% GL0016592 GL0016592 130 160 54% 8e-40 49% GL0021333 GL0021333 99.8 117 77% 2e-27 30% GL0090776 GL0090776 54.7 119 53% 4e-12 27% GL0083296 GL0083296 43.9 58.1 47% 4e-09 25% Vũ Trường Đức – 1302.K20 30 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC GL0091901 GL0091901 40.4 54.3 54% 3e-08 25% GL0079004 GL0079004 37.0 85.1 45% 5e-07 26% GL0050001 GL0050001 35.8 112 67% 8e-07 26% GL0106540 GL0106540 34.7 72.0 46% 2e-06 25% GL0119754 93.2 156 51% 3e-26 38% GL0039878 55.8 103 59% 2e-13 28% GL0122352 27.3 102 49% 4e-04 28% GL0068837 24.6 115 46% 0.002 25% GL0042431 22.7 84.3 51% 0.011 21% Nếu dựa điểm tối đa 200 độ tương đồng 37% trình tự khai thác đảm bảo yêu cầu (Bảng 3.5.2) Bảng 3.5.2 So sánh số lượng trình tự khai thác probe với dự đoán BGI Kết dự Kết khai thác Probe đoán BGI Mã gen Điểm Tổng Độ bao Giá trị Độ tối đa điểm phủ E tương GL0104795 GL0104795 382 382 99% 1e-130 đồng 48% GL0020896 GL0020896 285 285 62% 3e-96 54% GL0117445 GL0117445 285 285 62% 3e-96 54% Vũ Trường Đức – 1302.K20 31 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC GL0076106 GL0076106 243 259 85% 2e-77 38% GL0006405 GL0006405 227 271 58% 7e-75 57% GL0044986 GL0044986 225 256 87% 7e-72 37% GL0077826 GL0077826 216 265 67% 9e-70 48% GL0112518 GL0112518 216 265 67% 9e-70 48% Khảo sát lại vùng bảo thủ BLASTP trình tự chúng em thấy trình tự chứa vùng đặc thù cho xylosidase (specific hit) có vị trí hoạt động (active sites) (Hình 3.5) Hình 3.5 Kết dự đốn tương đồng đặc hiệu trình tự gốc hoạt động trình tự lựa chọn probe GH43 GH43_XYL: họ glycosyl 43 có khả phân hủy cấu trúc beta-D-xyloside; XynB2: enzyme betaxylosidase 3.6 Khảo sát cấu trúc bậc trình tự axit amin enzym xylan 1-4 beta xylosidase khai thác probe Vũ Trường Đức – 1302.K20 32 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC Cấu trúc bậc ba phân tử cho phép ước đoán cụ thể trung tâm hoạt động, cấu hình phân tử phối tử liên quan đến hoạt tính sinh học enzyme Vì trình tự khai thác có độ tương đồng thấp với gen ngân hàng gen dựa BLASTP nên chúng em sử dụng phần mềm Swiss Prot để ước đoán (Bảng 3.6) Bảng 3.6 Ước đốn cấu trúc bậc ba trình tự Swiss Prot Mã gen Pfam GL0104 PF0461 795 Hoạt tính Khn Độ Độ bao tương phủ đồng Xylosidase/ 3c2u.1.A arabinosidas 0.95 54.77 e Phương Cấu pháp trúc X-ray, 1.3Å Phối tử x B3P x XYSGL0117 PF0461 445 2exj.1.A beta-Dxylosidase 0.96 55.34 X-ray, XYS, 2.2Å x CA, x MES GL0076 PF0461 106 2exk.1.A beta-Dxylosidase 0.94 37.55 X-ray, 2.2Å homo- x XYStetrame XYS, r x CA, x MES x XYS- GL0006 PF0461 405 2exk.1.A beta-Dxylosidase 0.98 59.53 X-ray, XYS, 2.2Å x CA, x MES GL0044 PF0461 986 2exj.1.A beta-Dxylosidase 0.94 40.29 X-ray, 2.2Å x XYSXYS, x CA, Vũ Trường Đức – 1302.K20 33 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC x MES GL0077 PF0461 826 GL0112 PF0461 518 GL0001 PF0461 262 GL0095 PF0461 948 GL0015 PF0461 489 GL0088 PF0461 906 GL0016 PF0461 592 GL0021 PF0461 333 GL0090 PF0461 776 GL0083 PF0461 1yrz.1.A 1yrz.1.A 2exk.1.A 1yi7.1.A 2exh.1.A 1yrz.1.A 1yi7.1.A 1yrz.1.A 2exj.1.A beta-Dxylosidase beta-Dxylosidase beta-Dxylosidase beta-Dxylosidase beta-Dxylosidase beta-Dxylosidase beta-Dxylosidase beta-Dxylosidase beta-Dxylosidase 3c7g.1.A Endo-1,4- Vũ Trường Đức – 1302.K20 0.96 57.85 0.93 58.86 0.94 36.73 0.93 46.52 0.98 46.56 0.96 64.1 0.98 48.9 0.96 31.65 0.42 24.22 X-ray, 2.0Å X-ray, 2.0Å X-ray, 2.2Å X-ray, 1.9Å X-ray, 1.9Å X-ray, 2.0Å X-ray, 1.9Å X-ray, 2.0Å X-ray, 2.2Å 0.93 33.88 X-ray, 34 monom er monom er homotetrame r Không Không x XYSXYS, x CA, x MES homotetrame x CA r homotetrame r monom er x CA, x MES Không homotetrame x CA r monom er homotetrame r Không x XYSXYS, x CA, x MES monom Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI 296 6, beta- PF0342 xylanase KHOA CÔNG NGHỆ SINH HỌC 2.0Å er x XYP, x CA GL0091 PF0461 901 GL0079 PF0461 004 Endo-1,43c7g.1.A beta- 0.91 31.94 xylanase xylan beta1yrz.1.A 1,4- 0.94 18.62 xylosidase X-ray, 2.0Å X-ray, 2.0Å monom er monom er x XYP, x CA Không BetaGL0050 PF0461 001 xylosidase/al 3qee.1.A pha-L- 0.99 56.51 arabinfurano X-ray, 1.6Å monom er x CA sidase GL0106 PF0461 540 GL0119 PF0461 754 GL0039 878 sidase 2exh.1.A beta-Dxylosidase 0.81 42.77 1yrz.1.A 1,4- 0.94 31.09 xylosidase GL0068 PF0461 837 4nov.1.A rabinofurano 0.93 55.74 xylan beta- GL0122 PF0461 352 Xylosidase/a Endo-1,43kst.1.A beta- 0.9 36 xylanase 2exk.1.A beta-Dxylosidase Vũ Trường Đức – 1302.K20 0.89 25.68 35 X-ray, 1.3Å X-ray, 1.9Å X-ray, 2.0Å X-ray, 1.7Å X-ray, 2.2Å monom er homotetrame r monom er monom er x CA x CA, x MES Không x CA homo- x XYStetrame XYS, r x CA, Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC x MES GL0042 PF0461 431 Endo-1,43c7f.1.A beta- 0.82 32.08 xylanase X-ray, 1.5Å monom er x CA Chú thích: B3P: 2-[3-[[1,3-dihydroxy-2-(hydroxymethyl)propan-2-yl]amino] propylamino]-2-(hydroxymethyl)propane-1,3-diol; XYS: xylopyranose; CA: Ca++; MES: 2-morpholin-4-ium-4-ylethanesulfonate Kết Bảng 3.6 cho thấy hầu hết trình tự ước đốn có cấu trúc tương đồng cao với beta xylosidase, có số trình tự có hoạt tính tương tự xylanase arabinfuranosidase Các trình tự có hoạt tính khác trình tự có giá trị điểm tối đa (Max score) thấp 100 Các trình tự có điểm tối đa cao 200 có cấu trúc dự đốn tương đồng với enzyme beta-D-xylosidase thường có vị trí liên kết với ion Ca++ nằm vùng liên kết phân tử polymer để tạo dạng tetramer có vùng liên kết với xylopyranose đặc thù phân tử chất xylosidase, chứng tỏ chúng có hoạt tính phân cắt xylose thành đường (Hình 3.6) Điều hồn tồn phù hợp ước đốn cấu trúc chức phân tử Vũ Trường Đức – 1302.K20 36 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI Ca KHOA CÔNG NGHỆ SINH HỌC MES XYS A B Ca Ca XYP C D Hình 3.6 Cấu trúc bậc ba xylan beta xylosidase khuôn (template) 2exk.1.A (A), 1yrz.1.A (B), 1yi7.1.A (C), 3c7g.1.A (D) họ GH43 tương đồng với trình tự khai thác probe sử dụng Swiss prot B3P: 2-[3[[1,3-dihydroxy-2-(hydroxymethyl) propan-2-yl]amino] propylamino]-2(hydroxymethyl) propane-1,3-diol; XYS: xylopyranose; CA: Ca++; MES: 2morpholin-4-ium-4-ylethanesulfonate Vũ Trường Đức – 1302.K20 37 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC PHẦN IV: KẾT LUẬN VÀ KIẾN NGHỊ 4.1 Kết luận Đã phân loại thành 10 họ GH enzyme xylan 1-4 beta xylosidase sở số liệu thu thập từ CAZy Đã xác định được: họ GH (GH1, GH30, GH39, GH51 thuộc GH-A ) có cấu trúc khơng gian (β/α)8, họ GH43 thuộc nhóm lớn GH-F với mơ hình cấu trúc khơng gian gồm phiến β tạo thành cánh Xây dựng probe để khai thác triệt để trình tự mã hóa xylan 1-4 beta xylosidase GH43 phải có điểm tối đa 17,3 độ bao phủ độ tương đồng tối thiểu 60% 30% so với probe Sử dụng probe vừa xây dựng tìm kiếm 25 trình tự có hoạt tính xylan 1-4 beta xylosidase thuộc họ GH43, có 20 trình tự BGI dự đốn Phương pháp xây dựng probe dựa trình tự mã hóa enzyme xylan 1-4 beta xylosidase hướng để ứng dụng việc tìm kiếm trình tự đích từ liệu DNA metagnone Việc lựa chọn trình tự axit amin enzyme nghiên cứu chi tiết hoạt tính từ vi khuẩn để xây dựng 01 probe thuộc họ GH43 hỗ trợ hiệu cho việc lựa chọn gen mã hóa choxylan 1-4 beta xylosidase từ liệu khổng lồ DNA metagenome 4.2 Kiến nghị Tiếp tục nghiên cứu phát triển hoàn thiện probe để khai thác hiệu trình tự mã hóa xylan 1-4 beta xylosidase họ GH43 họ GH khác sở liệu DNA metagenome ruột mối Vũ Trường Đức – 1302.K20 38 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC TÀI LIỆU THAM KHẢO Tài liệu tiếng Anh Cantarel BL, Coutinho PM, Rancurel C, Bernard T, Lombard V, Henrissat B (2009) The Carbohydrate-Active EnZymes database (CAZy): an expert resource for Glycogenomics Nucleic Acids Res 37: pp 233-238 Chenna R, Sugawara H, Koike T, Lopez R, Gibson TJ, Higgins DG, Thompson JD (2003) "Multiple sequence alignment with the Clustal series of programs" Nucleic Acids Res 31 (13): pp 3497–3500 Do TH, Nguyen TT, Nguyen TN, Le QG, Nguyen C, Kimura K, Truong NH (2014) Mining biomass-degrading genes through Illumina-based de novo sequencing and metagenomic analysis of free-living bacteria in the gut of the lower termite Coptotermes gestroi harvested in Vietnam J Biosci Bioeng 118: 665–671 Hakulinen N, Turunen O, Janis J, Leisola M, Rouvinen J, (2003), Threedimensional structures of thermophilic beta-1,4-xylanases from Chaetomium thermophilum and Nonomuraea flexuosa Comparison of twelve xylanases in relation to their thermal stability, Eur J Biochem 270: pp.1399-1412 Henrissat B (1991) A classification of glycosyl hydrolases based on amino acid sequence similarities Biochem J 280: pp 309–316 Henrissat B, Davies G (1997) Structural and sequence-based classification of glycoside hydrolases Curr Opin Struct Biol 7: 637–644 Higgins DG, Bleasby AJ, Fuchs R (April 1992) "CLUSTAL V: improved software for multiple sequence alignment" Comput Appl Biosci (2): 189–91 Vũ Trường Đức – 1302.K20 39 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC Higgins DG, Sharp PM (1988) "CLUSTAL: a package for performing multiple sequence alignment on a microcomputer" Gene 73 (1): pp 237– 44 Koshland DE (1953) Stereochemistry and the mechanism of enzymatic reactions Biol Rev 28: 416–436 10.Lander, E S., Array of hope, Nature Genetics, 21:3–4, 1999 Lockhart, D.J., Dong, H., Byrne, M.C., Follettie, M.T., Gallo, M.V., Chee, M.S., Mittmann, M., Wang, C., Kobayashi, M., Horton, H., and Brown, E.L., Expression monitoring by hybridization to high-density oligonucleotide arrays, Nature Biotechnology, 14:1675–1680, 1996 11.Larkin MA, Blackshields G, Brown NP, Chenna R, McGettigan PA, McWilliam H, Valentin F, Wallace IM, Wilm A, Lopez R, Thompson JD, Gibson TJ, Higgins DG (2007) "ClustalW and ClustalX version 2" Bioinformatics 23 (21): 2947–2948 12.Linus Pauling, Robert B Corey, H R Branson, (1951), The structure of proteins: Two hydrogen-bonded helical configurations of the polypeptide chain, Proceeding of the National Academy of Sciences of the United States of American, 37 (4): pp 205 – 211 13.Lombard V, Golaconda Ramulu H, Drula E, Coutinho PM, Henrissat B (2014) The carbohydrate-active enzymes database (CAZy) in 2013 Nucleic Acids Res, 42: pp 490-495 14.Mitsuhashi, M., Cooper, A., Ogura, M., Shinagawa, T., Yano, K., and Hosokawa, T., Oligonucleotide probe design - a new approach, Nature, 367:759–761, 1994 15 Thompson JD, Gibson TJ, Plewniak F, Jeanmougin F, Higgins DG (1997) "The CLUSTAL_X windows interface: flexible strategies for Vũ Trường Đức – 1302.K20 40 Khóa luận tốt nghiệp VIỆN ĐẠI HỌC MỞ HÀ NỘI KHOA CÔNG NGHỆ SINH HỌC multiple sequence alignment aided by quality analysis tools" Nucleic Acids Research 25 (24): 4876–4882 16.Weilan Shao, Yemin Xue, Ailian Wu, Irina Kataeva, Jianjun Pei, Huawei Wu, Juergen Wiegel, (2011), Characterization of a Novel β-Xylosidase, XylC, from Thermoanaerobacterium saccharolyticum JW/SL-YS485, Appl Environ Microbiol 77 (3): pp 719-726 Vũ Trường Đức – 1302.K20 41 Khóa luận tốt nghiệp ... chiếu probe để lựa chọn gen mã hóa cho xylan 1-4 beta xylosidase từ số liệu DNA metagenome vi sinh vật ruột mối 2.2.5 Khai thác trình tự mã hóa xylan 1-4 beta xylosidase từ liệu DNA metagenome. .. NỘI KHOA CÔNG NGHỆ SINH HỌC KHÓA LUẬN TỐT NGHIỆP ĐỀ TÀI: XÂY DỰNG PROBE ĐỂ KHAI THÁC VÀ CHỌN GEN MÃ HÓA XYLAN 1-4 BETA XYLOSIDASE TỪ DỮ LIỆU GIẢI TRÌNH TỰ DNA METAGENOME Giáo viên hướng dẫn :TS... phương pháp để khai thác, lựa chọn gen mã hóa xylan 1-4 beta xylosidase từ liệu thực nghiệm hiệu cần thiết  Mục tiêu nghiên cứu Đưa phương pháp để xây dựng probe cho enzyme xylan 1-4 beta xylosidase
- Xem thêm -

Xem thêm: Xây dựng PROBE để khai thác và chọn gen mã hóa XYLAN 1 4 BETA XYLOSIDASE từ dữ liệu giải trình tự DNA METAGENOME , Xây dựng PROBE để khai thác và chọn gen mã hóa XYLAN 1 4 BETA XYLOSIDASE từ dữ liệu giải trình tự DNA METAGENOME , BÌA LÓT KHÓA LUẬN.pdf, DANH MỤC CÁC CHỮ VIẾT TẮT.pdf

Từ khóa liên quan

Gợi ý tài liệu liên quan cho bạn

Nhận lời giải ngay chưa đến 10 phút Đăng bài tập ngay