SPECIAL FOCUS: MOTION CONTROL June 23, 2011 A Penton Media Publication Tune in to EngineeringTV.com SIZING UP MOTION TRENDS, page 44 Making Servos Stable page 53 WHEN DOES IT MAKE SENSE TO MODIFY STANDARD PARTS? page 63 WORKING WITH ROLLER PINIONS, page 68 Where Do I Go for Automation Products? of Course! omegamation.com, Your single source for process measurement and control products! Thermocouple Terminal Blocks DIN Rail Mounting and Audit Capable Starts at $ Starts at $50 SL-PS Series Visit omega.com/sl-ps *DRTB Series DRTB-RAIL-3575, $7, sold separately Space Saving DIN Rail Power Supplies 5, 12, 24 and 48 VDC MADE IN With Built-In Connector Visit omega.com/drtb Threaded Capacitive Proximity Sensor E2K-X Series USA Starts at $ 127 Stepper Drives Integrated Stepper Drives/Motors with Advanced Features and Control Options Visit omega.com/stm_series Starts at $375 Configuration Software Included! STM Series Detect Metal and Non-Metal Targets FREE! Visit omega.com/e2k-x For Sales and Service, Call TOLL FREE Dilbert © United Feature Syndicate, Inc Visit omega.com to order your FREE copy of DilbertTM CONTROLCAT TM New Horizons® in Temperature, Pressure, Flow and More! Version No 28 Featuring 105 DILBERT Cartoons! Shop Online at No *PATENT PENDING RS# 101 omegamation.com TM © COPYRIGHT 2011 OMEGA ENGINEERING, INC ALL RIGHTS RESERVED VOLUME 83 ISSUE 11 JUNE 23, 2011 MOTIONTRENDS INDUSTRY FOCUS This schematic shows a typical motion-control hierarchy with a spline interpolator feeding a PID compensator, which provides a setpoint to the drive In this case, the physical hardware connection is abstracted away from the programmer The drive command output could be written to the drive via analog or any digital network FEATURES This schematic shows the same example but replaces the compensator with a state-space model, retaining the rest of the code In this case, the spline algorithm and communication method for sending the setpoint to the drive are untouched This lets the developer delve into the motion-control application at any level of interest All the vendor-supplied pieces including the API are retained Here are three trends making waves in the motion-control industry Shaping motion control The Top Three Trends top three trends 44 The shaping motion control While it’s true that the motion-control world hardly changes at an iPhone pace, it doesn’t mean there aren’t fascinating movements afoot And although there are a host of interesting trends and movements worth discussing, we will focus on three general trends: • Motion out-of-the-box • Power to the programmer • Machine builders – Easing their pain Motion out-of-the-box As staffing levels continue to shrink at OEMs, many machine builders are seriously questioning the long-held belief that shopping around for every component provides the highest value Instead, they’re turning to out-of-thebox devices as a better way to build machines and improve long-term value WANT MORE? Here are trends making waves in the motion-control industry Focus on this code image using your smartphone and free software from www neoreader.com, and you will be connected to related content on machinedesign.com http://tinyurl.com/3s73cs5 44 MACHINE Design.com First, motion out-of-the-box devices combine two or more motion-control devices into one These can include the controller, drive, motor, I/O, and gearhead This concept is not necessarily new, but it’s clear its popularity is growing fast The packaging sector is responsible for much of this attention The simplest out-of-the-box option is an integrated motor, or smart motor It consists of the drive electronics coupled with the motor and often a simple motion controller Over time, more devices such as smart actuators have entered the fray, building on the integrated motor concept by adding components such as gearheads and rotary-to-linear actuation Another out-of-the-box motion option gaining popularity is coupling the direct-drive motor to the load without any additional components such as coupling belts or gearheads This stiffens the mechanical connection to the load, effectively eliminating inertial matching, and leads to better performance than that of traditional servosystems Direct-drive motors also have higher bandwidths and effectively zero backlash Eliminating components reduces potential failure points and lets engineers boost performance with simpler installation compared to traditional servosystems JUNE 23, 2011 Engineers are also using another out-of-the-box opnew, cutting-edge machine to the market means you will tion, namely stepper torque control This technique inlikely have stringent weight, space, power, cost, and perforvolves operating a traditional stepmotor with classical sermance constraints that can’t be met by motion-out-of-thevocontrol methods by adding a feedback device, typically box approaches So a best-in-class component selection an incremental encoder Traditional field-oriented control algorithms permit true torque regulation as opposed to Authored by: current regulation found in microstepping drives StepBill Allai motors are just another type of brushless motor, or what Chairman the industry typically refers to as a permanent-magnet Motion Control Association synchronous motor (PMSM), but with more poles In Ann Arbor, Mich other words, it’s a brushless motor that benefits from the Edited by Stephen J Mraz same control techniques Using PMSM control eliminates stephen.mraz@penton.com stalling and excessive heat, common problems with tradiResources: tional stepmotor control And engineers can discard the Dassault Systèmes SolidWorks Corp., www.solidworks.com 2×-torque-guardband rule of thumb for stepmotors, not deal with PID tuning, and reduce the amount of cabling Delta Tau Data Systems Inc., www.deltatau.com All of this contributes to a less costly approach than a comHochschule Esslingen, www.hs-esslingen.de parable servo-based device Kollmorgen, www.kollmorgen.com In terms of performance, this approach does away with Mathworks, www.mathworks.com jitter (holding-position hunting) and can boost torque by a factor of four for servos spinning at up to 2,000 rpm The Motion Control Association, www.motioncontrolonline.org idea is to merge the best attributes of stepmotor machines National Instruments, www.ni.com with servocontrol to get a less-expensive, better performYaskawa, www.yaskawa.com ing motion-control system But there is a downside First, suppliers of this technology tend to be single-sourced and newer players in the industry And although the stepmotor is just a Advantages of out-of-the-box motion variation of PMSM, its high pole count limits maxiEND-USER BENEFIT RATIONALE mum speed to approximately 2,000 rpm, as opposed Quicker to market Reduces design and installation time to 10,000 rpm or higher for traditional PMSMs FiReduces cabling and potential Reduced maintenance nally, some users simply have a philosophical hang failure points up about using stepmotors for applications tradiEliminates or significantly reduces tionally served by servos Smaller size cabinet space or factory-floor So why aren’t all engineers jumping on the outrequirements of-the-box bandwagon? The fact is, introducing a JUNE 23, 2011 44 unstable servos 53 Taming Several factors can contribute to the likelihood of instability in an ac drive settle for 63 DonÕt standard parts MOTION Modifying off-the-shelf parts or customizing from scratch can simplify R&D and speed production Don’t settle for standard parts actuators that 68 Linear keep on rolling Roller pinions give linear actuators precise motion control with little to no backlash Modifying off-the-shelf parts or customizing from scratch can simplify R&D and speed production Test labs everything from qualifying products to evaluating performance under harsh operating conditions In a perfect world, no matter the application, commercial off-the-shelf (COTS) components would provide the exact performance required and be just the right size and shape In reality, almost every design involves trade-offs and compromise Sometimes, the process is painless, requiring some give on low-priority parameters Other times, the leap is simply too big Projects can get sidetracked as designers surf from one Web site to another or call around for catalogs, desperately searching for products that are in the right ballpark What’s often needed is customization Engineers involved with motion-control applications may not realize that the catalog is often only the start Many suppliers customize offerings to suit specific needs, support R&D with design insights fueled by experience, and even help with troubleshooting Partnering with knowledgeable vendors can improve the final product and speed commercialization Here’s how Custom brings benefits Customization sounds time consuming and expensive, but it doesn’t have to be In the simplest form, customization involves a vendor modifying its COTS products to save an OEM time, cost, and headaches Perhaps the most basic example is adding cables to a motor Many motors come with bare terminals, and users must connect the cables themselves It’s a simple task but not nearly as forgiving as many would like Bend the terminal once, it’s not a problem Bend the terminal twice and it often breaks Ideally, the motor would be sent back JUNE 23, 2011 MACHINE Design.com 63 63 Got answers? We’ve got the questions! www.smartestdesignengineer.com If you haven’t been there for a while, now is the time to check out the latest questions and see who’s top on the scoreboard MACHINE Design.com JUNE 23, 2011 Access our Reader Service Web site to quickly find and request information on the products and services found in the pages of MACHINE DESIGN www.machinedesign.com/rsc MACHINE Design.com 45 Agency Approvals for Drives: The SureServo family of brushless servo systems from AutomationDirect is fully digital and offers a rich set of features at dynamite prices Beginners to experienced users can take advantage of this easy-to-use family for as little as $965* (100W system) * All components sold separately Agency Approvals for Systems: Agency Approvals for Motors: SureServo drives accept a wide range of command sources: • • • • • Eight standard systems from 100 W to kW • Use with DirectLOGIC PLCs or any other host control • Drives feature on-board indexer and adaptive tuning modes • Free set-up software • year warranty CHECK OUT OUR PRICES Servo Systems Built-in motion controller with preset position, velocity or torque select presets with switch inputs and/or the multi-drop Modbus serial interface Position commands with “pulse/direction” or “count up/down” format Encoder follower Analog voltage Velocity or Torque command AutomationDirect Price/Part Number Allen-Bradley Price/Part Number Digital Servo Drive $484.00 $1,009.00 2098-DSD-005 100W Servo Motor with connectorized Leads $322.00 SVL-201 $531.00 Breakout Board Kit for CN1 Control Interface $93.00 ASD-BM-50A $209.00 10’ Motor Feedback Cable $49.50 SVC-EFL-010 $80.00 10’ Motor Power Cable $29.50 SVC-PFL-010 $90.00 2090-CPBM6DF-16AA03 Configuration Software FREE SV-PRO* $75.00 SVA-2040 TLY-A130T-HK62AA 2090-U3BK-D4401 2090-CFBM6DF-CBAA03 2098-UWCPRG *SureServo Pro software is FREE when downloaded and is also available for $9 on a CD Complete 1-axis 100W System For configuration, tuning and diagnostics, use the drive’s integrated keypad/display or take advantage of the free SureServo Pro™ PC-based software $ 978.00 1994.00 $ All prices are U.S list prices, AutomationDirect prices are from March 2011 Price List The Allen-Bradley 100W system consists of part numbers shown in table above with prices from www.rockwellautomation.com/en/e-tools 2/22/11 www.automationdirect.com www.automationdirect.com/servos or www.sureservo.com RS# 103 Go online or call to get complete information, request your free catalog, or place an order 1-800-633-0405 ON THE COVER DEPARTMENTS Servo-powered machine photo courtesy of Siemens Industry Inc EDITORIAL College classes for the wealthy 10 EDITORIAL STAFF 12 LETTERS 18 SCANNING FOR IDEAS Transporter moves heavy loads across factory floors Probe detects temperature of corrosive exhaust gases 22 REPORTER’S NOTEBOOK 34 LOOKING BACK 40 ADVANCED MANUFACTURING Product-analytics software boosts advanced manufacturing 42 BERKE ON SAFETY Inconvenient lockout/tagout likely gets ignored 73 ORR ON ENGINEERING Betrayed by technology! Editorial content is indexed in the Applied Science Technology Index, the Engineering Index, SciSearch and Research Alert Microfilm copies available from National Archive Publishing Company (NAPC), 300 N Zeeb Rd., P.O Box 998, Ann Arbor, MI 48106-0998, Ph: 734-302-6500 or 800-420-NAPC (6272), extension 6578 Permission to photocopy is granted for users registered with the Copyright Clearance Center (CCC) Inc to photocopy any article, with the exception of those for which separate ownership is indicated on the first page of the article, provided that the base fee of $1.25 per copy of the article, plus $.60 per page is paid to CCC, 222 Rosewood Dr., Danvers, MA 01923 (Code No 0024-9114/11 $1.25 + 60) Subscription Policy: MACHINE DESIGN is circulated to research, development, and design engineers primarily engaged in the design and manufacture of machinery, electrical/electronic equipment, and mechanical equipment To obtain a complimentary subscription see our Web page at submag.com/sub/ mn For change of address fill out a new qualification form at submag.com/sub/mn Printed in U.S.A., Copyright © 2011 Penton Media, Inc All rights reserved MACHINE DESIGN (ISSN 0024-9114) is published semimonthly except for a single issue in January and July by Penton Media, Inc., 9800 Metcalf Ave., Overland Park, KS 66212 74 PRODUCT SPOTLIGHT Gears & gearmotors 78 84 85 86 87 For customized article reprints and permissions please contact: Penton Reprints, 1-888-858-8851, e-mail at reprints@pentonreprints.com or visit pentonreprints.com PRODUCTS BUSINESS INDEX AD INDEX BUSINESS STAFF BACKTALK Paid subscriptions include issues 1-21 Issue No 22 (OEM Handbook and Supplier Directory) is available at additional cost Rates: U.S.: one year, $139; two years, $199; Canada: one year, $159; two years, $239; All other countries: one year, $199; two years, $299 Cost for back issues are U.S $10.00 per copy plus tax, Canada $15.00 per issue plus tax, and Int’l $20.00 per issue Product Locator, $50.00 plus tax Prepaid subscription: Penton Media (MACHINE DESIGN), P.O Box 2100, Skokie IL 600767800 Periodicals Postage Paid at Shawnee Mission, Kans., and at additional mailing offices Can GST #R126431964 Canadian Post Publications Mail Agreement No.40612608 Canada return address: Bleuchip International, P.O Box 25542, London, Ont., N6C 6B2 Digital subscription rates: U.S.: one year, $69; two years, $99; Canada: one year, $79; two years, $119; All other countries: one year, $99; two years, $149 POSTMASTER: Send change of address notice to Customer Service, MACHINE DESIGN, P.O Box 2100, Skokie, IL 60076-7800 MACHINE Design.com JUNE 23, 2011 Flexible and compatible I/O Learn about B&R IP20 and IP67 rated solutions at www.discover-automation.com 桂 Intelligent diagnostics for maximum machine performance 桂 6XSSRUWVRSHQ,2SODWIRUPVIRUÀHOGEXVWHFKQRORJ\ 桂 Minimal wiring for maximum CPU performance 桂 Innovative 3-piece design for “hot swapping” 桂 (DV\LQWHJUDWLRQLQWRH[LVWLQJWRSRORJLHV 桂 KLJKGHQVLW\,2RSWLRQV 桂 ,QWHJUDWHGVDIHW\IXQFWLRQV Perfection in Automation RS# 104 www.br-automation.com What’s new online machinedesign.com Free Webcast: How to quantifiably confirm adhesive cure June 23, 2011, 2:00 ET A major challenge for OEM’s, especially medical-device manufacturers, is verifying that a light-cure adhesive has fully cured Inappropriate or degraded light sources, or rapid processing speeds, can prevent complete curing While the adhesive may appear solidified, without time-consuming destructive physical testing or lab analysis, manufacturers have had no method to quickly and conclusively confirm the degree of cure This Webinar, presented by Henkel, discusses a simple and innovative in-line process that verifies curing and can improve manufacturing quality and production rates Learn more and register at http://tinyurl.com/3gqb5zv CSU’s 5.3-MW solar plant EngineeringTV tours Colorado State Univ.’s 30-acre, 5.3-MW photovoltaic solar plant The two-phase project, one with fixed collectors and the other tracking, is one of the largest at a U S university It supplies one-third of the electricity needed for their sprawling Foothills Campus and lets CSU purchase electricity produced by the plant at a fixed rate for 20 years Learn more at www.engineeringtv.com/video/53-megawatt-Solar-Plant-at-Col EDITOR’S WEB PICKS Conveyor blog RS# 105 MACHINE Design.com JUNE 23, 2011 Dorner Manufacturing has launched its Conveyor blog (www.blog.dornerconveyors com) Experts post on topics such as conveyor designs, unique applications, maintenance, and material handling in packaging, food, automation, medical, and other industries Readers can voice opinions, ask questions, and get immediate feedback Motion-control handbook The new Animatics catalog offers engineering details on servomotors, communication protocols, cables, and connectors, as well as linearharmonic drives and belt-slide systems It includes updates on recent motion-control advances and helps designers select, connect, and get products up and running Request or download a copy at www.animatics.com Switch finder Power-drain challenge EAO’s Web site (www.eao com) helps users sort through components such as illuminated pushbuttons, indicators, key switches, emergency-stop switches, and membrane-type human-machine interfaces Users can simultaneously search multiple criteria, including type, positions, protection class, and current rating, as well as application and market segment Other features include a product configurator and 3D drawings A dead mobile phone is inconvenient, to say the least So Nokia’s Power Drain Challenge seeks new, radical ideas to solve mobile power problems and extend a cell phone’s battery life Submissions to date include external power packs, fuel cells, and solar, kinetic, and bike chargers The contest runs through August and offers prizes for winning entries Learn more at www.ideasproject com/community/challenges/gear_ power RS# 106 EDITORIAL College classes for the wealthy With summer in full swing, let’s reflect a bit on summer jobs Back in the early 1970s, I landed a job one summer assisting industrial electricians We spent most of our time wiring machines that were to be installed on automotive assembly lines The most vivid recollection I have of that summer was the paycheck We worked a lot of hours, so we ended up making time-and-a-half and even double-time pay By the time I headed back to college, I had earned enough to pay for my next three semesters with a little left over My experience that summer wasn’t unique Several of my classmates had summer employment that paid for much or all of their next-year’s tuition And this was at a school considered to be among the top five U S engineering colleges Fast forward to today Summer jobs that will pay for more than a year’s worth of tuition at a major school are few and far between In a nutshell, tuition costs have risen dramatically, a fact well understood by parents with college-age kids Pay scales for jobs within reach of college students just haven’t kept up Consider what it now costs to educate a student for one year at a good engineering school At Purdue University, the annual in-state tuition alone runs $9,070 Supplies and room and board are extra Purdue students who don’t happen to reside in Indiana get a tuition bill for $26,622 Aspiring engineers at Georgia Tech pay an annual in-state tuition of $8,716 and an out-of-state tab of $26,926 To pull off a feat similar to my own in the 1970s, today’s college kids would have to find a three-month, 58-hour/week summer job paying north of $13/hour Those paying out-of-state tuition would need better than $38/hour to accomplish the same thing A point that also helps illuminate this situation is the current U S minimum wage of $7.25/hour Back in the 1970s, the minimum wage was below $3/hour My base rate that summer so long ago was above minimum wage, but not by much This analysis explains why many college students finish four years of school with both a degree and a large student loan debt I believe it also helps show why a significant number of engineering students abandon the engineering field and opt for careers in finance Consider that entry-level engineering jobs pay in the $60,000 range For analytical jobs in finance, the entry level is around $90,000, sometimes with a shot at bonuses that can equal that figure When you are starting a career with fistful of IOUs, that kind of money talks And finally there’s this: Efforts to encourage kids toward engineering careers get a lot of press these days It is a safe bet that most U S engineers come from middle-class backgrounds But a college education increasingly looks out of reach for many kids from middle-class homes So despite a lot of chest thumping by politicians about the need to reinvigorate manufacturing and boost exports, the high cost of a higher education makes it unlikely this will ever happen — Leland Teschler, Editor Congratulations to the May World’s Smartest Design Engineer Winners — Tony Ramos, Emmanuel Hitimana, Brett Weishalla, Ray Christy, and Gerald Hershman Their skills at answering challenging questions in eight different categories earned them each a $100 gift certificate The July prize period will be starting soon! RS# 107 JUNE 23, 2011 MOTION PRODUCTS Inverters boost productivity The 8400 inverter Series delivers stable and high dynamic performance A frequency inverter matches the speed and torque with process requirements Features include memory modules, online diagnostics, and optional safety subsystems The 8400 BaseLine, StateLine, HighLine, and TopLine versions are a scaled series of frequency inverters used to match application requirements The 8400 motec and protec inverters offer decen- DYNAMIC SOLUTIONS FOR MINIATURE PRECISION CLUTCHES tralized drives Identical installation, parameterization, and user operation across the 8400 Series makes for easy installation and operation of a single production line or entire factory Lenze Americas Corp., 630 Douglas St., Uxbridge, MA 01569, (800) 2179100, www.lenzeamericas.com RS# 622 n via formatio in e e s r f b ite at t Requesder Service We c o u r Re a com/rs Overload Protection w w w.m achine design Positioning systems Vacuum-compatible and nonmagnetic positioning system, for extreme operating conditions are covered in a Tension Control Force Control Torque Control Position Retention Hinge EXTENDS MACHINERY LIFE! ELIMINATES STICTION! • Long life - over 30 million cycles • Repeatable, accurate torque Indexing Soft Starts/ Cushioned Stops A Division of A&A Manufacturing www.Polyclutch.com Email: polyclutch@gortite.com Toll Free: 800-298-2066 Fax: 262-786-3280 RS# 161 70 MACHINE Design.com JUNE 23, 2011 new brochure The brochure features a variety of high-end piezoceramic stages, hexapod-6 axis positioners, and linear actuators Classic motorized precision positioners as well as nonmagnetic piezoworm-type motors, and ultrasonic motors and positioners are also covered PI (Physik Instrumente) L.P., 16 Albert St., Auburn, MA 01501, (508) 8323456, www.piezo.ws/pdf/Vacuum_ Positioners_Piezo_Systems_Hexapods RS# 623 pdf maxon compact drive Motor, sensor and controller in one RS# 162 maxon compact drive Three in one When it concerns compact drive intelligence, maxon compact drives are called for: motor, sensor and controller are all integrated in an aluminum case Link the drive through the CANopen network and solve even complex tasks with the programming tool included, "EPOS Studio", in no time at all maxon motor is the world’s leading supplier of high-precision drives and systems of up to 500 watts power output Rely on the quality of the highly specialized solutions which we develop with and for you www.maxonmotorusa.com RS# 163 RS# 164 Cost-Effective Solutions to Design Challenges With Powder Metallurgy (P/M), the Possibilities Are Virtually Endless! RS# 166 Why pay expensive machining costs when Symmco manufactures custom, high performance components (that range from simple to complex) at net or near net shape? Symmco offers: ● Economical P/M conversions ● Comprehensive design support ● Engineered assembly solutions ● Dynamic materials options ● Both high- and low-volume runs ● 24-hour turnaround on stock bearings, bars & plates Discover the Symmco Advantage – Superior Products & A Better Bottom Line Check out our new questions and a chance to win cash prizes! Your Key To Quality & Savings 40 South Park Street Sykesville, PA 15865 Phone: 814.894.2461 sales@symmco.com www.symmco.com ISO 9001:2008 CERTIFIED www.smartestdesignengineer.com RS# 165 72 MACHINE Design.com JUNE 23, 2011 ORR ON ENGINEERING Betrayed by technology! We trust that our security software will protect us from malware and the like Browser pop-ups ask users if they trust the entity trying to send a particular file So “trust” — a profoundly human verb — has moved into the technology arena and acquired additional meaning (As I grow older, I have a new appreciation for finding new uses for old things…) Betrayal of trust can, therefore, happen on both technological and human levels As we all know, on the human level, betrayal is emotionally devastating Lovers of technology (and I am one) view their computers, cell phones, and other electronic devices with more than simple acknowledgement of their utility We enter into relationships with these devices We don’t just use them — we often either love or hate them For example, writers have long documented the intense emotional relationships between men and automobiles Guys talk to their cars — especially older cars Remember the 10-dollar word “anthropomorphism”? It involves giving objects or animals human characteristics It certainly describes the guy-car relationship Consider that computers too are anthropomorphic They not only react to human input — they can operate independently! What’s more, computers communicate with us in words All my car ever said to me was, “Door is ajar.” But my computer makes sounds, music, voices, and writes me mystifying messages — like “fatal error 5939293829,” or “An unexpected error has occurred.” Meanwhile, more and more of our lives are bound up in computers Our work products are computer files, not paper Our calendars and to-do lists and address books are stored as ferromagnetic fluctuations Our bank accounts manifest as lists of numbers on the computer screen, rather than in cash Even our entertainment has moved to the computer An engineer colleague of mine has a multigigabyte hard drive devoted entirely to storing and playing MP3 files Photo albums have moved out of shoeboxes and into Web-based picturesharing services And don’t forget games, educational software, and movies — I now see more people on airplanes watching films on their laptop DVD players or on iPads than on the flight’s TV screens So these things are more than servant devices; they have become our friends We love them We are in awe of their capabilities We appreciate them And when they fail us — by crashing, behaving unpredictably, or eating our data and refusing to regurgitate it — we feel betrayed How could these powerful, beneficent slaves “turn on us”? Didn’t we keep them supplied with electricity? How can we bring ourselves to trust them again? That’s the key question — and it should restore us to reality Gentle reader, your computer is not a person It is a machine, and it is subject to entropy — the tendency of the universe toward increasing disorder Therefore, computers are not trustworthy! So don’t wait to recover from the emotional shock of a machine’s betrayal Immediately establish a functional, minimally invasive backup plan I use a service called DollyDrive with my Mac The original backup took a long time, even with my cable modem, but updates are now small enough they take just a few minutes every day Wikipedia has a great comparison table of online backup services, http://en.wikipedia.org/wiki/Comparison_of_online_backup_services You can also backup your computer yourself Today terabyte hard drives cost under $100 Also, keep your virus software up to date Microsoft’s protection is free Yes, I’ve been betrayed by “the instruments of darkness,” but I’m over it now And a little preventive care will let me avoid the emotional wrenching of betrayal — Joel Orr by technology in the future Joel Orr is Principal of Orr Associates International and Chief Visionary Emeritus of Cyon Research Corp Write him: joel.orr@gmail.com Edited by Leslie Gordon, leslie.gordon@penton.com JUNE 23, 2011 RS# 167 MACHINE Design.com 73 SPOTLIGHT GEARS Gearmotors Gear reducer features hollowbore rotary stage Precision planetary gears expand the company’s line of synchronous and stepper motors The gears come fully mounted on the company’s 8LSA, 8LVA, 8JSA, and 80MP Series motors, eliminating communication problems between motor and gear suppliers Gears in both straight and angled de- signs and with all conventional drive flange geometries are available The single-stage gears are standard for gear ratios i = 3, 4, 5, 8, and 10 and have ≤8 to 15-arc-min backlash Two and three-stage designs are also available The premium Series provides ≤1-arc-min backlash as an option paired with high output torques B&R Industrial Automation Corp., 1250 Northmeadow Pkwy., S-100, Roswell, GA 30076, (770) 772-0400, www br-automation.com RS# 446 & GEARMOTORS The STH servo-driven rotary actuator is a planetary gear reducer that includes a secondary hollow-bore rotary stage The planetary-gearreducer portion of the STH mounts to nearly all small to medium-duty servomotors It can be sized for reduction ratios between 12:1 through 324:1 Large cross-roller bearings within the rotary stage allow for thrust loads (maximum 800 lb) and torsional stiffness The offset, 85-mm hollow bore allows wiring, tubing, ball screw, etc to be passed through, making the STH suitable for small to medium indexing tables, robot end-effectors, dispensing assemblies, and custom automated-assembly equipment Nidec-Shimpo America Corp., 1701 Glenlake Ave., Itasca, IL 60143, (630) 671-2167, www.shimpodrives.com RS# 447 Brushless dc gearmotor The 801 Series brushless dc gearmotor, with integrated gearbox and electronics, offers versatile control for speed and torque in a compact, sealed package The unit has no brushes to wear out, making it well suited for medical equipment, lab automation, and industrial applications The Series increases the company’s BLDC line’s power rating from 80 to 205 W and torque range to 120 Nm Additional features include speeds from to 627 rpm for planetary models and 44 to 440 rpm for right-angle models; and standard IP54 sealing Crouzet North America, 2470 Coral St., Bldg D, Vista, CA 92081, (760) 597-6322, www.crouzet.com RS# 448 Planetary gearbox via mation ee infore Web site at r f t s e u Req der Servic o u r Re a /rsc sign.co m de Stand-alone planetary reducers feature a “floatachine w w w.m ing” sun gear and a ring gear around three planetary gears Unlike planetary gears that are fixed in place, the sun gear has a toothed central spline loosely fitted onto the shaft spline creating a floating sun gear The major advantage of the floating sun gear is the lower decibel level — less noise When clamped to the motor shaft, the sun gear rattles if tolerances vary at all, making it easy to tell if the gearbox is out of tolerance and load is distributed evenly between the gears The reducer’s standard mounting configuration allows mounting to any motor with a NEMA-23 or 34 input flange The standard design contains powdered metal gears The optional rugged design withstands less than ideal conditions and incorporates steel gears Groschopp, 420 15th St NE, Sioux Center, IA 51250, (800) 829-4135, www.groschopp.com RS# 449 74 MACHINE Design.com JUNE 23, 2011 SOLVE DIFFICULT SEALING PROBLEMS DYNAMIC SOLUTIONS CUSTOM Seal Master Inflatable Seals ® FOR MOTION CONTROL Faced with gaps, crevices, close tolerances, misaligned parts and awkward equipment designs – a custom elastomeric seal can be your solution to provide a leak-proof closure The last thing you need to worry about is a cable and hose carrier s Replaceable locking hubs provide secure connections s Cross bars and lid options allow optimum cable/hose protection and pick your width flexibility s Mounting hardware is designed to accommodate drop in replacement s Innovative accessories can provide replaceable wear surfaces, reduce tow force, and promote quiet operation s DEFLATED INFLATED TYPICAL INFLATABLE SEAL OPERATION 2D and 3D drawings downloadable from our web site When inflated it expands to the striking surface creating a positive seal When deflated it returns to its original configuration allowing free movement of one or both surfaces ® We design Nylatrac modular carrier solutions, so you don’t have to These seals are not simple rubber extrusions They are engineered, built and molded to fit your application and to meet strict performance, safety and environmental standards Fabric-reinforced for strength and structural integrity for optimum inflation/deflating operations, they are not subject to the compression set of ordinary seals Strong, versatile and flexible, Seal Master seals have been solving troublesome problems for industry since 1974 Design assistance offered SEAL MASTER CORPORATION A Division of A&A Manufacturing www.Gortrac.com Email: sales@gortrac.com Toll Free: 800-394-1547 Fax: 262-786-3280 Inflatable seals and other custom rubber products 368 MARTINEL DRIVE, KENT, OH 44240-4368 USA 800.477.8436 • 330.673.8410 • FAX 330.673.8242 E-mail: info@sealmaster.com • www.sealmaster.com © 2010 Seal Master Corporation RS# 168 RS# 169 Don’t slip up with ball screw actuators Tritex Linear and Rotary Actuators Choose the all-in-one actuator solution with roller screw technology Tritex™ is the compact, low maintenance motion solution with an integrated controller, amplifier, motor and advanced roller screw actuator, all in one efficient, sealed package Eliminate complexity and get the most performance in the smallest footprint Compare and learn more at www.exlarcorp.com Exlar’s patented Roller Screw actuators outperform ball screw actuators in life, load, speed and acceleration RS# 170 Controller Amplifier Motor Actuator SPOTLIGHT GEARS & GEARMOTORS Shaftgrounding ring The Aegis SGR bearing protection ring protects the bearings of VFDdriven motors from electrical damage A new all-inclusive Aegis Universal Mounting Kit (U-Kit) includes the ring and hardware to mount it on virtually any ac motor shaft The kit contains the correct size ring for the motor and four styles of brackets with bolts and lockwashers that can be used in various configurations, depending on the contours of the motor’s end bracket The ring prevents electrical “fluting” damage in the bearing, bearing noise, costly motor repairs/replacements, and downtime by safely channeling VFD-induced bearing currents to ground Conductive microfibers are embedded securely in the ring’s FiberLock channel and completely surround the motor shaft, providing millions of discharge points for harmful shaft currents, creating a path of least resistance that effectively diverts these currents away from bearings to ground If not diverted, the resulting currents discharge through bearings, causing fusion craters on bearing race walls (bearing fluting), which leads to noise, vibration, bearing failure, and catastrophic motor failure Electro Static Technology, 31 Winterbrook Rd., Mechanic Falls, ME 04256, (866) 738-1857, www.est-aegis.com RS# 450 RELIABLE ACCURATE ECONOMICAL STEPPER MOTORS SIXTY YEARS OF RELIABILITY Nippon Pulse has been designing and manufacturing stepper motors for the last 60 years, ensuring you get the most reliable product available COST EFFECTIVE, ACCURATE Tin-can CUSTOM ENGINEERED FOR YOUR APPLICATION A&A Manufacturing Company is your single-source provider of innovative protective cover products for: • Ball screws Precision slides • Robots • • UNMATCHED PRODUCT SUPPORT The widest variety of technologies and materials are used to protect in any environmental condition NPM • Linear rails & motors Machine ways A&A can design and deliver exactly what you need to keep your equipment in motion Hybrid Synchronous Linear Gearhead The ternary actuator is an all-in-one linear actuator that merges mechanics with intelligence, integrating controller, motor, amplifier and drive into one compact mechatronic device The unit is designed for linear or rotary compact motion For rotary motion, the basic ternary actuator can be used alone or paired with an alpha gearbox For linear requirements, a ball screw or slider is added to the device DYNAMIC SOLUTIONS Easily integrated into any system, our stepper motors offer a cost effective and accurate motion control solution When you choose a Nippon Pulse stepper, you’ll also get one-on-one product support unmatched in the industry If you have questions about integrating, prototyping, customizing, we have the answers All-in-one actuator A Division of A&A Manufacturing www.Gortite.com Email: sales@gortite.com Toll Free: 800-298-2066 Fax: 262-786-3280 Nippon Pulse Your Partner in Motion Control www.nipponpulse.com | info@nipponpulse.com | 1-540-633-1677 RS# 174 76 MACHINE Design.com RS# 172 JUNE 23, 2011 Planetary gearheads Software is included for setting function parameters Wittenstein Inc., 1249 Humbracht Circle, Bartlett, IL 60103, www wittenstein-us.com RS# 451 The Micron AquaTrue planetary gearheads handle the demanding requirements of food, beverage, and pharmaceutical handling; packaging; and dispensing applications Featuring 300-Series stainless-steel external housings for maximum corrosion resistance, the gearheads are IP67 protected to provide reliable operation and long life in environments subject to caustic cleaning chemicals and high-pressure wash down The round housing has no external seams, eliminating the potential for bacteria collection or ingress The gearheads come in 60, 80, 120, and 160-mm frame sizes, with ratios from 3:1 to 10:1, torque capacity up to 876 Nm, and precision to 13 arc-min The self-lubricating gearheads are for high-precision motion-control applications requiring high torque to volume ratio, high torsional stiffness, and low backlash Thomson, 1500 Mittel Blvd., Wood Dale, IL 60191, (540) 633-3549, www.thomsonlinear.com RS# 452 No Compromise Swiss Precision Precision Linear Guide Elements 3-63mm diameter Tel 203-730-8741 mailamt@agathonusa.com ISO 9001/EN 29001 www.agathon.com RS# 173 RS# 171 JUNE 23, 2011 MACHINE Design.com 77 PRODUCTS formation via Request free in ice Web site at our Reader Serv w w w.machine Low-profile support beam A new track support beam for MinVee, a low-profile, miniature linear-slide system, securely joins MinVee track to customer mounting substrates and ensures adequate clearance for carriages to travel freely on the track The track support is made from extruded 6063-T6 aluminum alloy and is clear anodized for corrosion resistance The lightweight track support is available in single-piece lengths up to 10 ft Longer track lengths can be If your equipment is built for performance, our rod ends are built for you design.com/r sc supported with multiple, butt-jointed track supports The track support is predrilled with clearance holes that match the track mounting hole pattern for quick and easy assembly Clearance-hole-drilled track can be mounted with top-inserted standard screws over flat mounting substrates with predrilled tapped holes or T-slots up to 10 mm in width with standard screws and T-nuts Threadedhole-drilled track can be mounted to flat mounting substrates with predrilled clearance holes with standard screws inserted from under the substrate Offering axial load capacities up to 121 lb and speeds up to m/sec, the MinVee consists of a four-wheel carriage riding a long-life, double-edge hardened steel track The Size-0, 0.5-in.-wide track features a self-aligning mounting shoulder that reduces installation time and cost Bishop-Wisecarver Corp., 2104 Martin Way, Pittsburg, CA 94565, (925) 4398272, www.bwc.com RS# 465 Servo peaks at >900 W • Self-lubricating, injection-molded nylon race rod end • Maintenance free, low friction, moisture resistant • Superb wear resistance • Wide operating temperature range • RoHS compliant plating • Low carbon steel, medium carbon alloy steel, stainless steel • SAE and metric sizes • Made in USA Get Connected www.cablecraft.com 78 MACHINE Design.com RS# 175 JUNE 23, 2011 The Cablecraft Solution The SM3416DT-PLS2 SmartMotor features high-speed position capture for demanding packaging, labeling, and vision registration applications; advanced torque overshoot braking for added safe stopping of high moment of inertia loads; modetorque-brake for fast smooth stops during E-stop or other faults; and a new eight-pole, segmented stator design that packs greater than 900 W peak power — over hp — into the cube-shaped servo The SmartMotors consist of a servomotor, amplifier, encoder, and motion controller It delivers up to 480 oz-in of peak torque while maintaining over 200 oz-in of continuous torque with a maximum speed capability of over 5,000 rpm Animatics Corp., 3200 Patrick Henry Dr., Santa Clara, CA 95054, (408) 748 8721, www.animatics.com RS# 466 RS# 177 RS# 176 EPOXY ADHESIVE FEATURES HIGH PEEL STRENGTH AND SHOCK RESISTANCE MASTER BOND EP21TDCHT � Cures at room temperatures � Easy-to-use: to mix-ratio, weight or volume � High peel and shear strength � Impact, vibration and shock resistant � Serviceable from -100°F to +350°F � Superb electrical insulation properties � Especially suitable for bonding substrates with different coefficients of expansion � Chemical resistant � Convenient packaging Prompt Technical Assistance Linear Velocity Transducers for Velocity Measurement & Control No Excitation High Sensitivity Voltage Required High Frequency Response Strokes from 1/2 to 36 inches Instantaneous Reading Perfect for machine control, R&D and testing, including injection molding ram rate; glass pulling rate; shock absorber profiling; et al 800/828-3964 154 Hobart St., Hackensack, NJ 07601 TEL: 201-343-8983 � FAX: 201-343-2132 RS# 178 www.masterbond.com � main@masterbond.com www.lvdtsensor.net Free 76-page catalog Also includes LVDT Position, Angular Displacement & Gaging Transducers RS# 179 PRODUCTS Belt conveyor The 3200 Series iDrive belt conveyor integrates the motor, gearbox, and motor controller all within the conveyor’s frame This sleek, space-saving design allows the conveyor to fit into the tightest of spaces Designed for heavy-duty industrial and packaging applications, the iDrive’s robust frame and motor can carry more weight, operate at faster speeds, and comes in larger sizes The conveyor also comes with indexing capabilities to handle more-sophisticated conveying applications The unit comes with three control options and is ready to use for quick integration into existing packaging and processing lines Side controls allow operators to adjust speed and direction, and an internal brushless dc motor is maintenance-free Maximum weight of the 80-fpm unit is 120 lb; the 133-fpm unit is 69 lb; and the 171-fpm is 52 lb Specifications include to 24-in width; to 12-ft length; V-guided belts for maintenance-free tracking; rack-and-pinion belt tension; built-in tension indicators; two T-slots for fast mounting of automation components; and quick 5-min belt changes Dorner Mfg Corp., Box 20, 975 Cottonwood Ave., Hartland, WI 53029, (262) 367-7600, www.dorner.com RS# 467 Multiaxis drive The AMP-43240 multiaxis drive is a four-axis servodrive that provides up to 750 W/axis It resides inside the DMC4040 or DMC-4143 four-axis motioncontroller enclosure The packaging of the multiaxis drives with the motion controller saves cost, space and wiring 80 MACHINE Design.com RS# 180 JUNE 23, 2011 The 43240 contains four transconductance, PWM amplifiers for driving brushless servomotors at 20 to 80 Vdc Each amplifier drives motors operating up to 10-A continuous, 20-A peak/axis The amplifier’s gain settings are user programmable at 0.5, 1.0, and 2.0 A/V, and its switching frequency is 24 kHz The amplifier offers overvoltage, undervoltage, overcurrent, short-circuit, and over-temperature protection Galil Motion Control Inc., 270 Technology Way, Rocklin, CA 95765, (800) 377-6329, www.galilmc.com RS# 468 Closed-loop dc speed control The OMDC-MD Series speed control is for dc motors rated to hp The programmable control with digital closed-loop feedback and LED display features adjustable minimum/maximum speeds, adjustable acceleration/ deceleration, and display options including decimalpoint positions and intensity Pulse-input capacity for speed feedback is 50,000 pulses/ (833 Hz) Its nonvolatile memory provides programmable power-on initial settings and lets custom settings be stored The control can be programmed to display any engineering unit of measure Omega Engineering Inc., One Omega Dr., Stamford, CT 06907, (203) 359-1660, www.omega.com RS# 469 Lubriplate com Rotary actuators The line of SLM and SLG rotary actuators are now available with Class I, Division Certification, meeting application requirements for use in hazardous environments The units offer the same features as the standard models, including brushless servomotor and gearmotor technology for high torque-tosize ratio With the Class I, Division option, these actuators provide motion control for applications where flammable gases or vapors may be present The actuators are suited for operating quarter-turn or multiturn valves or shaft-drive dampers Directly coupled shaft-to-shaft, they eliminate cumbersome mechanisms needed by the linear motion of pneumatics Featuring segmented lamination-stator technology — consisting of individual segment phase wiring and high coercive strength magnets — the servomotors provide continuous modulating service Additional features include high loadbearing design; integrated armature and sungear for SLG models; Class I, Division 2, Groups A, B, C, and D certified; and a terminal box with NPT ports The SLM Series offers multiple frame sizes and produces speeds of 4,000 rpm The SLG Series comes in 90 and 115-mm frame sizes, and one, two, or three-stack lengths with single and double reductions Exlar Corp., 1470 Lake Dr W, Chanhassen, MN 55317, (952) 368-3434, www exlar.com RS# 470 ® SPECIFY THE SYNTHETIC ADVANTAGE LUBRIPLATE ® PGO SERIES POLYALKYLENE GLYCOL (PAG)-BASED GEAR OILS Advanced PAG-Based Formula • Ultra High-Performance Lubrication for Gear Reducers operating under the most demanding conditions • They Reduce Friction, Wear, and Thermal Build-Up (Reductions up to 15˚F in Worm Gear Reducers) • Exceeds 12 Stages of FZG Test Conserves Resources - ECO-Friendly • Extended Service Life and Drain Intervals, reduces lubricant requirements over time • Low Coefficient of Friction - Reduced Energy Consumption (Up to 7% in Worm Gears) • Free of zinc and other additives that may be undesirable in environmentally sensitive areas PGO-FGL - H-1 Class Food Grade • Same Great Benefits in Food Machinery Grade • NSF H-1 Registered, Meets FDA Regulations 21 CFR 178.3570 A Better Lubrication Solution Than Petroleum-Based Lubricants! Lubriplate ® Synthetic Lubricants Contact: Ellen Girard / OEM Marketing Analyst Tel: 973-465-5731 / E-mail: egirard@lubriplate.com For Equipment Recommendations and Lubricant Specifications RS# 181 JUNE 23, 2011 MACHINE Design.com 81 PRODUCTS Linear actuator The programmable, motorized SplineRail linear actuator combines mechanical drive, guidance, and control in a single component The actuator uses a Size 17 single-stack or double-stack stepper motor with the company’s IDEA drive The IDEA drive incorporates a custom-designed graphic-user interface for easy programming using onscreen buttons instead of complicated command sets The Back In Power ElectroCraft products have been powering applications for more than a half-century And, now we’re stronger than ever The combination of EAD Motors, AGI Motors, EllectroCraft Engineered Solutions, eMotion drives and Automotion drives has created an ElectroCraft with more product range, technology and global presence than ever before With manufacturing operations in the United States, United Kingdom, Germany and China we have developed a multi-national team and worldwide resources that are committed to helping OEMs design, develop and build next-generation products across the globe No matter where in the world you need us, were ready to power your innovation CompletePower { Motion Products } RapidPower { BLDC Motors } TorquePower { Stepper Motors } DirectPower { PMDC Motors } AxialPower { Linear Actuators } MobilePower { Mobility Products } SolidPower { AC Motors } SurePower { C-Frame AC Motors } ElectroCraft CompletePower™ Stepper Drives If you need a simple, compact way to control your application, our CompletePower stepper and servo drives are the answer Featuring meticulous engineering, advanced electronics, and the long-lasting reliability that comes with the ElectroCraft name, you can count on CompletePower to keep your innovation moving Electro Craft powering innovation ® TM For more information or to find an ElectroCraft Representative email: info@electrocraft.com • phone: 919-847-3067 • online: www.electrocraft.com RS# 182 82 MACHINE Design.com JUNE 23, 2011 interface lets the program be “tested” using a line-by-line execution feature for easy troubleshooting and modification The actuator uses a precision rolled leadscrew supported by bearings and contained within a concentric aluminum spline, driving an integrated When mounted vertically, the device can also be used to simultaneously lift and rotate (Z-theta motion) With one motor driving the screw and a second rotating the rail, a self-supporting pickand-place mechanism can be created Screw leads are available from 0.05 to 1.2-in /rev, providing a wide range of performance profiles, including selflocking threads that support a load without external power or breaks Haydon Kerk Motion Solutions Inc., 1500 Meriden Rd., Waterbury, CT 06705, (203) 756-7441, www.haydonkerk.com RS# 471 Universal rack-roller-pinion system The roller-pinion, universal rack model — also available in premium and standard rack models — delivers precise linear positioning with zero backlash The device provides thrust ratings of 750 to 10,500 N Unlike traditional rack-and-pinion systems, the unit features a roller-pinion/ toothed-rack combination The pinion’s bearing-supported rollers engage a tooth profile precisely measured to provide positional accuracy and eliminate cumulative error As a result, it delivers positional accuracy to ±50 μm (±0.002 in.), and an innovative meshing action resulting in less than μm (± 0.0002 in.) of backlash The unit features durable alloy-steel construction and/or corrosive-resistant stainless steel that requires periodic lubrication The rack installs with a flange-mount pinion and preloader Racks are available in standard and 0.5-m lengths or custom cut to certain lengths Nexen Group Inc., 560 Oak Grove Pkwy., Vadnais Heights, MN 55127, (651) 484-5900, www.nexengroup.com RS# 472 INDUSTRIAL MICROHYDRAULICS High Flow, Compact Size Smallest GPM Check Valve Ever! • Save Space – Most Compact Design in it’s Class • Low Leakage Metal-to-Metal Seat • 100% Performance Tested • Easy to Install Innovation in Miniature The Lee Company Pettipaug Road Westbrook, CT 06498 sorvillon@theleeco.com Tel: 800-533-7584 RS# 184 RS# 183 +0018#6+10"914- 0COSCQR?DPCC !?@JC&MQC!?PPGCP 2CAFLGA?J%SGBC!?R?JME 8KUKVMCDGNUEJNGRREQOQTECNN #RRNKECVKQP5RGEKHKE /14'126+105GPUWTGUVJCV[QWoNNIGVVJG4+)*651.76+10 HQT[QWTECDNGJQUGECTTKGTCRRNKECVKQP 5?W5GNCPQ PMRCARGTC!MTCPQ 2NCUVKE5QNWVKQPU 9JGPKVEQOGUVQECDNGCPFJQUGECTTKGTUPQDQF[IKXGU[QWOQTGQRVKQPUVJCP 75657$#-+CPF-#$'.5%*.'22%JQQUGHTQOOKETQUK\GFVQUWRGTFWV[ UVGGNRNCUVKECPFJ[DTKFECTTKGTU#XCKNCDNGKPCYKFGTCPIGQHQRGPVWDGCPF URGEKCNRTQDNGOUQNXKPIFGUKIPU !MLRGLSMSQ$JCV !?@JCQDMP+MRGML 'ZVTC2TQVGEVKQP OQTG126+105OQTG51.76+105 AACQQMPGCQ $MP!?@JC!?PPGCPQ KIJV3WKGV'EQPQOKECN %CDNG*QUG %CTTKGT5[UVGOU *[DTKF6WDGU 1NPMAICRQ 2NCUVKE /GVCN%QODQ MUCP2P?LQKGQQGML !MKNMLCLRQ *GCX[&WV[5VGGN #LEGLCCPGLE !F?GLQ *KIJ5VTGPIVJ6GORGTCVWTG4GUKUVCPV4WIIGF 0MJJCP !F?GLQ 025( OQTG241&7%6126+105OQTG51.76+105OQTG':2'4+'0%'OQTG5'48+%'OQTG8#.7' -CDGN5EJNGRR#OGTKECGQLMU?BGTGQGMLMD756UWDCMK2QYGT6TCPUOKUUKQP % $GLBMSRFMU-#$'.5%*.'22 657$#-+/14'CVI?@CJQAFJCNN [...]... complex design, along with constantly changing regulations, makes aerodynamics an evolving challenge, says Frank Michaux, aerodynamic engineer at Toyota Resources: Motorsport in Germany Tecplot, www.tecplot.com The open-wheel design of Toyota Motorsport, www F1s disrupts airflow, creating toyota-motorsport.com wakes behind the front wheels, which, while local, can affect the entire vehicle’s performance,... FEATURES Leslie Gordon, leslie.gordon@penton.com Kenneth J Korane, ken.korane@penton.com Stephen J Mraz, stephen.mraz@penton.com CAD/CAM MECHANICAL Leslie Gordon, leslie.gordon@penton.com Kenneth J Korane, ken.korane@penton.com Jessica Shapiro, jessica.shapiro@penton.com ELECTRICAL, ELECTRONICS Robert J Repas, Jr ., robert.repas@penton.com EDITORIAL PRODUCTION FASTENING, JOINING Denise Greco, Editorial Production... spec, source and apply • Up to 600V-rated • RJ4 5, M12 and Variant 1 connectivity • High Flex to 10 million cycles • TPE, PVC, Plenum and PUR cable jackets Advanced solutions, single source Allen-Bradley: Connect with Confidence Download your free SERIOUS SENSING eToolkit: abConnectivity.com/MD/4 Copyright © 2011 Rockwell Automation, Inc All Rights Reserved AD RS2205-R1/3P RS# 132 JUNE 2 3, 2011 MACHINE Design. com... generator (a pressurized vessel ), CCD digital camera, high-power laser, an optical device that converts a la22 MACHINE Design. com JUNE 2 3, 2011 ser beam into a sheet of light, and dedicated software For PIV tests, engineers position the camera at 90º to the plane of the flow field they want to examine The generator floods the tunnel with tiny particles of di-ethyl-hexyl-sebacat (DEHS ), which have nearly the... helped deLaboratory, www.lanl.gov velop the catalyst MD GREAT TECHNOLOGY IS ONLY GREAT IF IT CAN BE DELIVERED www.linearmotiondelivered.com Design Now, Deliver Now RS# 126 JUNE 2 3, 2011 MACHINE Design. com 27 The RSM2800 Magnetic Encoder counts turns, measures angles down to the last degree, and remembers shaft positions without power Don’t try this with other encoders: imagine your machine with the RSM2800... screens can be How they compare 2011 MAZDA6 I TOURING PLUS $2 4,2 40 2.5-liter I4 170 @ 6,0 00 167 @ 4,0 00 22/31 193.7 72.4 57.9 3,3 29 16.6 2011 HONDA ACCORD EX 5-SPD AT Price Engine Horsepower Torque (lb-ft) EPA fuel economy (city/highway mpg) Length (in.) Width (in.) Height (in.) Curb Weight (lb) Cargo (ft3) $2 4,9 05 2.4-liter I4 190 @ 7,0 00 162 @ 4,4 00 23/34 194.9 72.7 58.1 3,3 62 14 Get our Anti-Stiction... firsta pollen filter on the air condiquarter orders came from the tioner, a tilting and telescoping automotive industry, where steering wheel, and front and sales jumped 64 %, says the side air bags, along with side air RIA Meanwhile, orders from curtains, traction and stability the metals sector climbed control, ABS, and fog lights 73 %, and life sciences/ The only option our car pharmaceutical/biomedical... now we’re riding the moonroof, power side mirrors, upsurge in automotive slightly large wheels and tires, investment in robotics and Bluetooth phone and audio automation,” said John capability, an eight-way power Dulchinos, chair of RIA’s driver seat, upgraded stereo, Statistics Committee electroluminescent gages, and RIA estimates that some some small touches of leather 20 3,0 00 robots are now and interior... withstands temperatures to 2,2 80°F MgO insulation Ungrounded enclosed sensing tip protected against sulfuric exhaust gases r formation via ou Request free in Web site at ice rv Se Reader c design. com/rs ww w .machine GREAT TECHNOLOGY IS ONLY GREAT IF IT CAN BE DELIVERED www.linearmotiondelivered.com Design Now, Deliver Now RS# 120 20 MACHINE Design. com JUNE 2 3, 2011 Keep Your Machine Running! Festo’s VTUB... Technology have developed an articulated, snakelike robot that could one day maneuver and navigate through complex environments, including the rubble and debris left after earthquakes, bombings, and other disasters They modeled their robot after the sandfish lizard, a reptile that can “swim” through sand, thanks, they thought, to its wedge-shaped head To test that theory, researchers added a wedge-shaped