Characterization of a novel 24 kda hemin binding protein, hmuy, in porphyromonas gingivalis w50
Characterization of a novel 24 kda hemin binding protein, hmuy, in porphyromonas gingivalis w50
... 5’-TTATTTAACGGGGTATGTATAAG-3’ hmuY’_BamHI_Fwd 5’-CCGGGATCCATGAAAAAAATCAT-3’ hmuY_XhoI_Rev 5’-AATCTCGAGTTATTTAACGGGGTA-3’ hmuY_BamHI_Fwd 5’-CGCGGATTCATGGCTCTTCACCGCTATGA-3’ hmuY_XhoI_Rev 5’-AATCTCGAGTTATTTAACGGGGTA-3’ ... LDS-PAGE and TMBZ staining 85 4.11.1 Hemin- binding assay of fusion proteins 85 4.11.2 Hemin- binding assay of proteins with GST tags removed 86 4.12 Construction of a hmuY’ isogenic mutant of P gingivalis ... of ATP -binding cassette (ABC) transport system (Davidson and Chen, 2004) These ABC transport systems are usually made up of a soluble periplasmic subtrate binding protein, a permease and an ATP-binding...
- 170
- 198
- 0
Báo cáo khoa học: Characterization of a hemocyte intracellular fatty acid-binding protein from crayfish (Pacifastacus leniusculus) and shrimp (Penaeus monodon) pdf
... AGCAATAG and 596– ACGAGGAAGCGAAGGATGA TGATGG) were chosen to amplify a 139-base pair fragment of the plFABP Primers specific to the crayfish ribosomal 40S gene (156+ GACGAATGGCATACACCTGAG AGG and ... binding of RA and ⁄ or fatty acid molecules The biological roles of these proteins span over a wide range of processes such as transport, cellular uptake and cytoplasmic trafficking of fatty acids, and ... ensis has been shown to bind retinoic acid (RA) and retinal [4], and another recombinant putative CRABP from Manduca sexta [5] has been found to bind saturated as well as unsaturated fatty acid,...
- 11
- 545
- 0
Báo cáo Y học: Identification and characterization of a novel activated RhoB binding protein containing a PDZ domain whose expression is specifically modulated in thyroid cells by cAMP pot
... PDZ domain showing 30% identity with the PDZ domains existing in a wide variety of proteins The protein ends by a potential PDZ binding domain motif (SSWY) and contains at least two potential ... presence of activated RhoB (Fig 4D) Regulation of p76RBE mRNA in vitro in thyroid cells As p76RBE was initially isolated from a dog thyroid cDNA library and its mRNA was induced in vivo by thyrotropin ... existence of a Rho -binding domain (HR-1) in the amino terminal part of the protein suggests an implication in transduction pathways involving the Rho proteins By use of the two-hybrid system and...
- 9
- 394
- 0
Tài liệu Báo cáo khoa học: Isolation and molecular characterization of a novel D-hydantoinase from Jannaschia sp. CCS1 docx
... A novel high-activity D-hydantoinase from Jannaschia sp CCS1 obtain optically pure amino acids, namely chemical and enzymatic syntheses Chemical synthesis gives racemic mixtures of amino acids ... precipitate fraction; sup, supernatant fraction The molecular weight standard (lane M) is indicated on the right A novel high-activity D-hydantoinase from Jannaschia sp CCS1 Fig Purification of HYDBp ... high-activity D-hydantoinase from Jannaschia sp CCS1 Y Cai et al Experimental procedures Genome mining and identification of putative D-hydantoinase genes Using the amino acid sequence of HYDBp (AAL37185)...
- 14
- 621
- 0
Tài liệu Báo cáo Y học: Identification and characterization of a mammalian 14-kDa phosphohistidine phosphatase pdf
... Dr Ake Engstrom at the Peptide Synthesis and Analysis Laboratory ¨ of the Department of Medical Biochemistry and Microbiology, Uppsala University The SP6 primer 5¢-ATT TAG GTG ACA CTA TAG-3¢ and ... its absorbance at 315 nm, appeared as a peak at 0.33 M MDEA and was essentially stable in this buffer at +4 °C for at least months The phosphate content of the The standard assay of the phosphohistidine ... suitable substrate for estimates of the 14-kDa phosphohistidine phosphatase activity in crude extracts that also contain other phosphatases The identification of natural substrates of the 14-kDa phosphohistidine...
- 8
- 666
- 0
Tài liệu Báo cáo Y học: Characterization of a novel silkworm (Bombyx mori ) phenol UDP-glucosyltransferase potx
... project A wing disc cDNA library derived from fifth instar B mori C108 larvae was kindly provided by Dr Kawasaki (University of Utsunomiya, Japan) A total of 1000 clones were selected at random and ... the ATG start codon) for cDNA synthesis and 5¢-CCGTGATTGTTGAGTG GATG-3¢ and 5¢-AAGCAACTCCAGTAGACACG-3¢ (position 386–405 and 769–750, respectively, from the ATG start codon) for PCR amplification ... nucleotides of upstream and 54 nucleotides of downstream untranslated sequence A consensus polyadenylation signal (AATAAA) was identified 30 nucleotides downstream of the TAA stop codon The cDNA clone...
- 7
- 470
- 0
Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx
... sequence VBARP-L 1.9 VBARP-S 1.3 AACAATGCTGACTGATAGCGGAGGA (Forward) TAAGCTACTACGTAAAGAATATATC (Reverse) GATAAGGTACCTGCACTGACACGGATGAAAGC (Forward) CATATATTCTTTACGTAGTAGCTTA (Reverse) FEBS Journal 272 ... identified and functionally characterized VBARP, a novel splice variant of ANKHD1 Human ANKHD1 gene is a large transcript containing multiple ankyrin repeat motif domains and a single KH domain similar ... Molecular characterization of ANKHD1 splice variant studies blast searches of VBARP revealed that this protein has homology to human ankyrin repeat and KH domain containing 1 (ANKHD1) variants,...
- 12
- 561
- 0
Báo cáo khoa học: Structural characterization of a novel branching pattern in the lipopolysaccharide from nontypeable Haemophilus influenzae pot
... Schweda, E.K.H (2001) A rapid and sensitive procedure for determination of 5-N-acetyl neuraminic acid in lipopolysaccharides of Haemophilus in uenzae: a survey of 24 nontypeable H in uenzae strains ... HexNAc1ÆHex5ÆHep4ÆAnKdo-ol (Tables and 4) The Table Negative ion ESI-MS data and proposed compositions for O-deacylated lipopolysaccharide (LPS-OH) of nontypeable Haemophilus in uenzae (NTHi) strain 981 Average ... abundance was estimated from the area of molecular ion peak relative to the total area (expressed as percentage) Peaks representing less than 3% of the base peak were not included in the table Observed...
- 13
- 433
- 0
Báo cáo khoa học: Molecular characterization of a novel nuclear transglutaminase that is expressed during starfish embryogenesis ppt
... ACATGTACATGTATATCACTTTGAACTGGTTTTCATTAAAAAAAAAAAACCATCAATTTG AGAAGAAACAATTACTTCTTAAGTCAATTAATTTTTCTAGAAATGCAAAAGATATTCCCC TTAACAGCTGTTTGAAATGAGGCCTCGGTCTCAAGTTTAAGAGTGCCCCCATATGTAAGC TAAAAAGCTCCAGGAAGTTGACCCAGAAGAAATTTGTTAAGAGTTCACGGATAAGCAAGG ... A H V T L N V K S A * ATGCGAGGTCAGCATTTATCCAACCAGAAGCTTCACGGAGCTAGCTGGGCAAGGAAATTT GATAATCGCAAGAAATAATTTCCCCCCAAAAACAAAAGGTTGTTGGCTGAAAATACTTCT ACATGTACATGTATATCACTTTGAACTGGTTTTCATTAAAAAAAAAAAACCATCAATTTG ... TAAAAAGCTCCAGGAAGTTGACCCAGAAGAAATTTGTTAAGAGTTCACGGATAAGCAAGG TATTTGGATAAGGTGCATTTGTACATTTTGTGTGTACTGGTTTAGTGTAGAATTTAATTT TTTTTGGTTAATTCTGTCACAAGAACATAATTCTATGGTTACTACACAATGTTGCATCCC AACGCCACCTTTTTATTTTTAATCATATATCATCTCAGTGAAGGTCAGTCCTTG...
- 11
- 501
- 0
Báo cáo khoa học: Identification and functional characterization of a novel barnacle cement protein pptx
... VPPPCDFSIKSKQKQVGVTAGGASVSAKGATSGSGSITCITKTPTSVTKKVAAGNAGVSG Mrcp19k Bacp19k Bicp19k 70 80 90 100 110 120 TSVSAGDGAFGNLAAALTLVEDTEDGLGVKTKNGGKGFSEGTAAISQTAGANGGATVKKA VSASAANGFFKNLGKATTEVKTTKDGTKVKTKTAGKGKTGGTATTIQIADANGGVSEKSL AAAAAGNGVFKNLVTALTNISTTDDITKVQTQTIGSGGTGGAATILQLADANGGAALKEV ... underwater material surfaces was analyzed by: (a) quantitative amino acid analysis; and (b) SPR Protein adsorption to glass and a positively charged polymer were evaluated by quantification of the ... GC-3¢ and 5¢-AAC TCC GTG GAG AAG AAG AA-3¢ for the first PCR amplification; and 5¢-TGC TGA CCG ACG CGC CTC CT-3¢ and 5¢-GGC AAC ACG GGC GTC ACC GC-3¢ for the second PCR amplification The 102 bp DNA amplified...
- 11
- 488
- 0
Báo cáo khoa học: Characterization of a novel long-chain acyl-CoA thioesterase from Alcaligenes faecalis docx
... MO, USA Bacterial strain The strain isolated from soil samples was identified as a bacterium, A faecalis according to Bergey’s Manual [31], and was designated A faecalis ISH108 The strain has been ... sample was withdrawn and assayed for activity by the DTNB method using stearoyl-CoA as substrate (c) In an analogous manner, when stearoyl-CoA was used as 2379 Thioesterase of Alcaligenes faecalis ... 8.67 – – 2380 acetate propanoate butanoate hexanoate dodecanoate palmitate stearate FEBS Journal 273 (2006) 2374–2387 ª 2006 IMTECH P Shahi et al Thioesterase of Alcaligenes faecalis Reagent (1 mM)...
- 14
- 513
- 0
Báo cáo khoa học: cDNA cloning and characterization of a novel calmodulinlike protein from pearl oyster Pinctada fucata potx
... nucleotide sequence of oyster CaLP cDNA obtained by RACE, a PCR reaction was performed using a pair of specific primers P3 (5¢-GGAAGAATACAGACACGGACAG-3¢) and P4 (5¢-ATAACAACAGTTTATACATCGCTTC-3¢) corresponding ... metabolism and calcium signaling pathways Experimental procedures RNA preparation and cDNA synthesis Adult specimens of P fucata were purchased from Guofa Pearl Farm, Beihai, Guangxi Province, China Tissues ... 5¢-untranslated sequence, an open reading frame consisting of 483 bp, a TGA stop, a 146 bp 3¢-untranslated sequence, and a poly (A) tail of 18 nucleotides A putative polyadenylation signals (AATAAA)...
- 12
- 375
- 0
Báo cáo khoa học: Detection and characterization of a novel extracellular fungal enzyme that catalyzes the specific and hydrolytic cleavage of lignin guaiacylglycerol b-aryl ether linkages pdf
... (Fig 3A) These results indicated that the b-aryl ether cleavage enzyme accumulated and was stable in the extracellular fraction The extracellular fraction of 2BW-1 generated abundant GG and 4MU ... radiolabeled water was not observed with guaiacol It was clear that the b-aryl ether cleavage enzyme catalyzed the addition of two molecules of H2O (at Ca and Cb positions) and cleavage the b-aryl ... cleave the b-aryl ether linkages of GOUbz (III) and GOGbz (IV) In addition, the b-aryl ether cleavage enzyme failed to cleave the b-aryl ether linkage of GOU aO (Fig structure V) Thus, the b-aryl...
- 10
- 670
- 0
Báo cáo y học: "The identification and characterization of a novel protein, c19orf10, in the synovium" docx
... staining (g) Intense staining of a hyperplastic RA synovial lining cell layer This staining was typical of most areas of RA synovium where the lining was hyperplastic (h) An area of an RA synovial ... stained positively (arrow) (e) Intense staining of individual cells in the lining layer of a typical OA synovium (f) An area of an OA synovium demonstrates a lining layer completely devoid of ... synovial lining layer and perivascular regions of RA (OCT section) tissue.(b) Intense staining of the synovial lining layer and perivascular regions of OA (paraffin section) tissue (c) An area demonstrating...
- 9
- 489
- 0
Báo cáo y học: "Characterization of a novel and spontaneous mouse model of inflammatory arthritis" pptx
... A, Yamazaki K, Hosono N, Myouzen K, Tsunoda T, Kamatani N, Furuichi T, Ikegawa S, Ohmura K, Mimori T, Matsuda F, Iwamoto T, Momohara S, Yamanaka H, Yamada R, Kubo M, Nakamura Y, Yamamoto K: A ... mice at early and late stages of disease Serum was isolated from AR and NAR littermates, and the levels of six cytokines were measured by cytometric bead array Only (A) IL-6 and (B) TNF -a were ... Comparative Pathology Laboratory at the University of California, Davis An animal necropsy was performed, and numerous organs and tissues were harvested for analysis Sections were examined and...
- 18
- 383
- 0
Từ khóa: Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấpNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDEPhát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longNghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếTìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinChuong 2 nhận dạng rui roQuản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Nguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtChiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015MÔN TRUYỀN THÔNG MARKETING TÍCH HỢPTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲQUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ